PHPackages                             yoosuf/docit - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Templating &amp; Views](/categories/templating)
4. /
5. yoosuf/docit

ActiveLibrary[Templating &amp; Views](/categories/templating)

yoosuf/docit
============

Laravel package for production document generation from DOCX and PDF templates with idempotency, queues, and template inspection.

v1.0.2(1mo ago)12↓75%MITPHPPHP ^8.1

Since Jul 16Pushed 1mo agoCompare

[ Source](https://github.com/yoosuf/dockit)[ Packagist](https://packagist.org/packages/yoosuf/docit)[ Docs](https://github.com/yoosuf/dockit)[ RSS](/packages/yoosuf-docit/feed)WikiDiscussions main Synced 1w ago

READMEChangelogDependencies (8)Versions (4)Used By (0)

Docit for Laravel
=================

[](#docit-for-laravel)

Production-ready document generation for Laravel from DOCX and fillable PDF templates.

Docit helps teams ship contracts, invoices, certificates, and operational documents with a reliable API-first workflow.

Why teams adopt Docit
---------------------

[](#why-teams-adopt-docit)

- Ship document automation without building your own fragile rendering pipeline.
- Keep requests safe with idempotency for retried API calls.
- Run generation sync or async with queue retries/backoff controls.
- Inspect templates before production use to catch placeholder and field issues early.
- Persist generation metadata for auditability and troubleshooting.

Core capabilities
-----------------

[](#core-capabilities)

- Convention-based template discovery
- DOCX rendering with PhpWord TemplateProcessor
- Fillable PDF AcroForm rendering with pdftk
- DOC and DOCX conversion with LibreOffice
- Template inspection endpoint with placeholders, warnings, and errors
- Idempotency key support for create requests
- Queue-backed async generation with configurable retry policy
- Metadata persistence with Laravel models

Installation
------------

[](#installation)

```
composer require yoosuf/docit
```

Quick start (5 minutes)
-----------------------

[](#quick-start-5-minutes)

```
php artisan vendor:publish --tag=document-config
php artisan vendor:publish --tag=document-migrations
php artisan migrate
```

Store templates in your configured templates directory and call your document endpoint.

Commands and CLI workflow
-------------------------

[](#commands-and-cli-workflow)

Docit package itself does not register custom Artisan commands. It relies on Laravel's standard setup commands plus your host application's CLI commands.

### Package setup commands

[](#package-setup-commands)

```
php artisan vendor:publish --tag=document-config
php artisan vendor:publish --tag=document-migrations
php artisan migrate
```

How they work:

- `vendor:publish --tag=document-config`: copies package config to `config/document.php` so you can override defaults.
- `vendor:publish --tag=document-migrations`: publishes migration files to your app for full control over schema lifecycle.
- `migrate`: creates required tables (`documents`, `templates`, `generation_events`, `idempotency_keys`, `jobs`).

### Host app CLI commands (example from this repo)

[](#host-app-cli-commands-example-from-this-repo)

If your host app includes command wrappers, you can run generation from terminal using the same service pipeline as the API.

```
php artisan document:make-sample-invoice-template
php artisan document:generate-document invoice pdf --template-format=word --data='{"invoice_number":"INV-1001"}'
php artisan document:generate-document invoice pdf --template-format=word --sales-order-id=1001 --async
```

What these commands do:

- `document:make-sample-invoice-template`: generates a starter DOCX template with placeholders.
- `document:generate-document`: validates input options, builds a document input object, and calls generate (sync) or queue (async).
- `--async`: dispatches a queue job; worker executes the same generation pipeline with retry/backoff policy.

Full command reference and internal flow:

- `docs/CLI_COMMANDS.md`

Use case: Generate contracts, agreements, and certificates without HTML templates
---------------------------------------------------------------------------------

[](#use-case-generate-contracts-agreements-and-certificates-without-html-templates)

Docit is designed for teams that want document output from real office templates (DOCX/PDF), not Blade or HTML-to-PDF rendering.

### Workflow

[](#workflow)

1. Your legal or operations team prepares templates in Word or fillable PDF:
    - `employment_contract_v1.docx`
    - `service_agreement_v1.docx`
    - `completion_certificate_v1.docx`
2. Save templates in `DOCUMENT_TEMPLATES_DIR`.
3. Send business data as JSON to the document API.
4. Docit merges placeholders and returns a generated document file.

### Contract generation example

[](#contract-generation-example)

```
{
	"document_type": "employment_contract",
	"output_format": "pdf",
	"template_format": "word",
	"data": {
		"employee_name": "Jane Doe",
		"employee_address": "21 Lake Road",
		"position": "Operations Manager",
		"start_date": "2026-08-01",
		"salary": "6500",
		"currency": "USD",
		"company_name": "Acme Logistics LLC"
	}
}
```

### Agreement generation example

[](#agreement-generation-example)

```
{
	"document_type": "service_agreement",
	"output_format": "docx",
	"template_format": "word",
	"data": {
		"agreement_number": "SA-2026-104",
		"client_name": "Northwind Trading",
		"provider_name": "Acme Consulting",
		"effective_date": "2026-07-16",
		"term_months": 12,
		"service_scope": "ERP implementation and support"
	}
}
```

### Certificate generation example

[](#certificate-generation-example)

```
{
	"document_type": "completion_certificate",
	"output_format": "pdf",
	"template_format": "pdf",
	"data": {
		"recipient_name": "Ali Hassan",
		"program_name": "Safety Compliance Training",
		"completion_date": "2026-07-15",
		"certificate_id": "CERT-2026-7781"
	}
}
```

### Why this approach scales

[](#why-this-approach-scales)

- Non-developers can update legal text/layout directly in DOCX or PDF templates.
- Engineering sends structured data only, no HTML/CSS print maintenance.
- Output is consistent across sync and queued async generation.
- Idempotency prevents duplicate documents during retries.

Common use cases
----------------

[](#common-use-cases)

Docit can power most operational document workflows where data lives in Laravel and output must be DOCX or PDF.

- Payslips and salary statements
- Employment contracts and offer letters
- Employment certificates and experience letters
- Service agreements and NDAs
- Invoices and tax documents
- Purchase orders and sales order confirmations
- Delivery notes and shipping documents
- Onboarding forms and compliance acknowledgements
- Training completion certificates
- Internal approval forms and signed records

Scenario playbook
-----------------

[](#scenario-playbook)

### Payroll and HR scenarios

[](#payroll-and-hr-scenarios)

- Payslips: generate monthly PDF payslips from a DOCX template with placeholders such as base salary, allowances, deductions, and net pay.
- Employment contracts: generate role-specific contract documents from legal-approved DOCX templates and output as PDF for final issuance.
- Employment certificates: generate service certificates with dynamic dates, department, and designation.
- Offer letters: produce DOCX for edit/review and PDF for final archival.

### Legal and operations scenarios

[](#legal-and-operations-scenarios)

- Client agreements: render agreements from versioned templates per region/business unit.
- Vendor contracts: keep standard clauses in templates while injecting vendor and pricing data via JSON.
- Compliance forms: fill standardized PDF forms for regulatory workflows.
- Certificate issuance: generate branded certificates in bulk with queue mode.

### High-volume scenarios

[](#high-volume-scenarios)

- Monthly payroll runs (thousands of payslips) via async queue mode.
- Batch certificate generation after training completion.
- Re-issue flows with idempotency keys to avoid duplicate files.

Document-to-PDF conversion scenarios in PHP
-------------------------------------------

[](#document-to-pdf-conversion-scenarios-in-php)

Docit supports conversion paths commonly needed in Laravel backends.

Input templateOutput requestedBackend pathDOCXDOCXPlaceholder merge using PhpWord TemplateProcessorDOCXPDFMerge in DOCX, then convert via LibreOffice headless modeDOCDOCXConvert legacy DOC to DOCX via LibreOfficeDOCPDFConvert DOC to DOCX/PDF via LibreOffice pipelineFillable PDFPDFFill AcroForm fields with pdftk### Recommended conversion strategy

[](#recommended-conversion-strategy)

1. Keep a canonical editable template in DOCX for business/legal updates.
2. Generate PDF for distribution and long-term archival.
3. Use async mode for large runs to avoid request timeouts.
4. Use versioned template naming (`*_v1`, `*_v2`) for safe rollouts.

### Conversion caveats to plan for

[](#conversion-caveats-to-plan-for)

- Font availability: ensure server has required fonts used by Word templates.
- Layout drift: complex Word features may render slightly differently in PDF conversion.
- Timeouts: long conversions should run in queue workers with tuned timeout/backoff.
- Binary availability: LibreOffice and pdftk must be installed and reachable by configured binaries.

PDF form filling details
------------------------

[](#pdf-form-filling-details)

For fillable PDF templates (AcroForms), Docit maps JSON payload keys to PDF field names and renders a final PDF.

### How field mapping works

[](#how-field-mapping-works)

1. Build a fillable PDF template with stable field names.
2. Use the same field names as JSON keys in `data`.
3. Submit create request with `template_format` set to `pdf`.
4. Docit fills fields using pdftk and stores output metadata.

### Field types commonly supported

[](#field-types-commonly-supported)

- Text fields (single-line and multi-line)
- Numeric/currency fields (as formatted strings)
- Date fields
- Checkbox fields (mapped with expected export values)
- Radio/select fields (template-dependent)

### PDF form best practices

[](#pdf-form-best-practices)

- Keep field names machine-friendly and stable (`employee_name`, `gross_salary`).
- Avoid duplicate field names unless mirrored values are intentional.
- Validate templates with the inspect endpoint before production use.
- Keep legal static text in the PDF itself, and only inject dynamic fields from JSON.
- Test a sample payload per template version before enabling queue batches.

### Example: payslip PDF payload

[](#example-payslip-pdf-payload)

```
{
	"document_type": "monthly_payslip",
	"output_format": "pdf",
	"template_format": "pdf",
	"data": {
		"employee_name": "Sara Khan",
		"employee_id": "EMP-2199",
		"pay_period": "2026-07",
		"basic_salary": "4000.00",
		"allowances": "450.00",
		"deductions": "120.00",
		"net_pay": "4330.00"
	}
}
```

Performance: why Docit is fast in real workloads
------------------------------------------------

[](#performance-why-docit-is-fast-in-real-workloads)

Docit is optimized for operational throughput where you may generate hundreds or thousands of files per run.

- Template-first processing avoids browser rendering overhead.
- No CSS layout engine warmup per job.
- Queue-native execution lets you scale workers horizontally.
- Idempotency avoids duplicate work during retries.
- Conversion pipeline is predictable and easy to benchmark.

### Practical speed expectations

[](#practical-speed-expectations)

- Small to medium templates typically complete quickly in sync mode.
- Bulk runs are best in async queue mode for steady throughput.
- Worker scaling can increase total documents/minute without changing application code.

Actual performance depends on template complexity, server CPU, storage speed, and installed binary versions.

Benchmark report: Docit vs Browsershot
--------------------------------------

[](#benchmark-report-docit-vs-browsershot)

Docit is generally a better fit than Browsershot for contract, certificate, and payslip pipelines where throughput and operational reliability matter more than browser-accurate web rendering.

High-level findings:

- Better throughput consistency in queue-based batch runs.
- Lower memory pressure per worker in sustained generation jobs.
- Faster cold-start behavior because there is no Chromium bootstrapping.
- More stable output for legal and form-centric templates maintained outside frontend stacks.

Read the full benchmark report and methodology:

- `docs/BENCHMARK_REPORT.md`

Documentation
-------------

[](#documentation)

- Architecture and problem-solution design: `docs/ARCHITECTURE.md`
- Benchmark report: `docs/BENCHMARK_REPORT.md`
- Command reference and CLI internals: `docs/CLI_COMMANDS.md`

Why this is ideal vs HTML-to-PDF generation
-------------------------------------------

[](#why-this-is-ideal-vs-html-to-pdf-generation)

HTML-to-PDF is useful for web-like layouts, but template-driven document generation is often better for legal and operational documents.

### 1) Better ownership model

[](#1-better-ownership-model)

- Legal, HR, and operations teams can maintain DOCX/PDF templates directly.
- Engineering focuses on data contracts and API reliability, not print CSS fixes.

### 2) Higher output consistency

[](#2-higher-output-consistency)

- Word/PDF templates preserve document intent (sections, clauses, fixed legal wording).
- Fewer rendering surprises caused by browser/CSS differences.

### 3) Lower maintenance cost

[](#3-lower-maintenance-cost)

- No parallel HTML print templates to maintain.
- No recurring CSS-for-paper troubleshooting cycle.

### 4) Stronger compliance and audit workflows

[](#4-stronger-compliance-and-audit-workflows)

- Stable, versioned templates improve traceability.
- Metadata persistence and generation events support operational audits.

### 5) Safer at scale

[](#5-safer-at-scale)

- Idempotency + queues provide controlled retry behavior.
- Bulk jobs are resilient to transient failures and worker restarts.

### 6) More natural fit for form-centric workflows

[](#6-more-natural-fit-for-form-centric-workflows)

- Fillable PDF forms map directly to domain fields.
- Structured JSON payloads can populate standard forms consistently.

Marketing snapshot
------------------

[](#marketing-snapshot)

Docit is the production document engine for Laravel teams that need speed, reliability, and business-friendly template ownership.

- Build once, generate forever: contracts, payslips, agreements, and certificates from real templates.
- Ship faster: remove HTML-to-PDF maintenance from your roadmap.
- Operate confidently: idempotency, queue retries, and generation tracking built in.
- Scale smoothly: from single documents to high-volume batch pipelines.

### One-line pitch

[](#one-line-pitch)

Docit turns Laravel into a reliable document factory for DOCX and PDF workflows without HTML template debt.

Configuration
-------------

[](#configuration)

Primary config file:

- `config/document.php`

Important environment variables:

- `DOCUMENT_API_PREFIX`
- `DOCUMENT_LOAD_ROUTES`
- `DOCUMENT_TEMPLATES_DIR`
- `DOCUMENT_OUTPUT_DIR`
- `LIBREOFFICE_BINARY`
- `DOCUMENT_CONVERSION_TIMEOUT_SECONDS`
- `PDFTK_BINARY`
- `DOCUMENT_QUEUE_ATTEMPTS`
- `DOCUMENT_QUEUE_BACKOFF_FIRST_SECONDS`
- `DOCUMENT_QUEUE_BACKOFF_SECOND_SECONDS`
- `DOCUMENT_QUEUE_BACKOFF_THIRD_SECONDS`
- `DOCUMENT_QUEUE_MAX_EXCEPTIONS`
- `DOCUMENT_QUEUE_TIMEOUT_SECONDS`

Positioning statement
---------------------

[](#positioning-statement)

If your team is generating operational documents inside Laravel and needs reliability, traceability, and queue-safe retries, Docit is purpose-built for that workflow.

Contributing
------------

[](#contributing)

Issues and pull requests are welcome.

- Issues:
- Source:

License
-------

[](#license)

MIT

###  Health Score

38

—

LowBetter than 83% of packages

Maintenance90

Actively maintained with recent releases

Popularity4

Limited adoption so far

Community6

Small or concentrated contributor base

Maturity44

Maturing project, gaining track record

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~0 days

Total

3

Last Release

45d ago

### Community

Maintainers

![](https://avatars.githubusercontent.com/u/64164?v=4)[Yoosuf Mo](/maintainers/yoosuf)[@yoosuf](https://github.com/yoosuf)

---

Top Contributors

[![yoosuf](https://avatars.githubusercontent.com/u/64164?v=4)](https://github.com/yoosuf "yoosuf (3 commits)")

---

Tags

apiautomationcomposer-packagedocument-generationdocxidempotencylaravelpackagistpdfphpqueuetemplate-engineapilaravelpdfqueuedocxtemplatingidempotencydocument generation

### Embed Badge

![Health badge](/badges/yoosuf-docit/health.svg)

```
[![Health](https://phpackages.com/badges/yoosuf-docit/health.svg)](https://phpackages.com/packages/yoosuf-docit)
```

###  Alternatives

[psalm/plugin-laravel

Psalm plugin for Laravel

3365.5M359](/packages/psalm-plugin-laravel)[laravel/pulse

Laravel Pulse is a real-time application performance monitoring tool and dashboard for your Laravel application.

1.7k17.6M165](/packages/laravel-pulse)[laravel/horizon

Dashboard and code-driven configuration for Laravel queues.

4.2k104.7M369](/packages/laravel-horizon)[pressbooks/pressbooks

Pressbooks is an open source book publishing tool built on a WordPress multisite platform. Pressbooks outputs books in multiple formats, including PDF, EPUB, web, and a variety of XML flavours, using a theming/templating system, driven by CSS.

45945.2k1](/packages/pressbooks-pressbooks)[laravel/scout

Laravel Scout provides a driver based solution to searching your Eloquent models.

1.7k59.5M712](/packages/laravel-scout)[laravel/mcp

Rapidly build MCP servers for your Laravel applications.

80732.6M270](/packages/laravel-mcp)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
