PHPackages vskstudio/takt-symfony - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Templating & Views](/categories/templating) 4. / 5. vskstudio/takt-symfony ActiveSymfony-bundle[Templating & Views](/categories/templating) vskstudio/takt-symfony ====================== Symfony bundle for Takt analytics: takt() Twig function + autowired Takt service for server-side events. v0.5.0(3w ago)012MITPHPPHP >=8.1CI passing Since Jun 12Pushed 3w agoCompare [ Source](https://github.com/vskstudio/takt-symfony)[ Packagist](https://packagist.org/packages/vskstudio/takt-symfony)[ Docs](https://github.com/vskstudio/takt-symfony)[ RSS](/packages/vskstudio-takt-symfony/feed)WikiDiscussions main Synced 1w ago READMEChangelog (2)Dependencies (17)Versions (9)Used By (0) takt-symfony ============ [](#takt-symfony) Symfony bundle for [Takt](https://github.com/vskstudio) analytics. It wires the Takt snippet into your templates through a `{{ takt() }}` Twig function and exposes an autowired `Takt` service for server-side events. Installation ------------ [](#installation) ``` composer require vskstudio/takt-symfony ``` If you use [Symfony Flex](https://symfony.com/doc/current/setup/flex.html), the bundle is enabled automatically. Otherwise add it manually to `config/bundles.php`: ``` return [ // ... Vskstudio\Takt\Symfony\TaktBundle::class => ['all' => true], ]; ``` Configuration ------------- [](#configuration) Create `config/packages/takt.yaml`: ``` takt: domain: 'example.com' endpoint: 'https://taktlytics.com' # defaults to the hosted Takt origin script_origin: null # first-party origin to dodge ad-blockers (see below) api_key: '%env(TAKT_API_KEY)%' mode: 'inline' # inline | cdn | asset | sdk (sdk = full ES-module init(), needed for scrub_url) outbound: false files: false file_extensions: [] # e.g. ['pdf', 'zip']; empty keeps the tracker default list tagged: false # track elements marked with data-takt-event not_found: false # track 404 pageviews exclude_localhost: true nonce: null # CSP nonce for the inline (request-scoped) # Advanced options — null keeps the tracker defaults. sample_rate: null # e.g. 0.5 keeps ~50% of hits track_query: null # true keeps the raw query string + hash in URLs query_params: [] # params to keep when track_query is off, e.g. ['utm_source'] exclude: [] # path prefixes never tracked, requires mode: sdk (e.g. ['/app','/account']) respect_dnt: null # false stops honoring the Do-Not-Track header enabled: null # false disables tracking entirely (kill-switch) scrub_url: null # raw JS fn to rewrite URLs; requires mode: sdk (dev-controlled only) ``` The `api_key` must be **ingest-scoped and domain-bound**. Keep it out of source control via an environment variable. `script_origin` is the first-party origin to serve the tracker + derive the endpoint from (`{origin}/api/event`) — your Takt domain or a custom domain you proxy through to dodge ad-blockers (`endpoint` wins over it). `endpoint` is the server-side ingest base origin. It defaults to the hosted Takt origin `https://taktlytics.com`, so a fresh install works out of the box; set it explicitly to point at a self-hosted or custom ingest origin. Autocapture is opt-in. `outbound`, `files`, `tagged` and `not_found` each add a token to the single `data-auto` attribute read by the bundled tracker; `file_extensions` narrows which downloads count. The advanced options map to the engine's `sampleRate`, `trackQuery`, `queryParams`, `respectDnt` and `enabled`. `exclude` maps to the engine's `exclude` (path prefixes never tracked) and, like `scrub_url`, only works in `mode: sdk`. `scrub_url` is a **raw JS function** injected verbatim, so it only works in `mode: sdk` (a full ES-module `init()` render) — keep it dev-controlled and never build it from user input. Client-side tracking -------------------- [](#client-side-tracking) Call the `takt()` Twig function inside the `` of your base template: ``` {# ... #} {{ takt() }} ``` ### Modes [](#modes) - `inline` — the tracking script is embedded directly in the page. - `cdn` — a `` tag pointing at the Takt CDN is rendered. - `asset` — a `` tag pointing at a self-hosted asset is rendered. - `sdk` — a `` boots the full SDK via `init()`; required for `scrub_url`. Server-side events ------------------ [](#server-side-events) Autowire the `Takt` service in any controller or service: ``` use Vskstudio\Takt\Revenue; use Vskstudio\Takt\Takt; final class CheckoutController { public function __construct(private readonly Takt $takt) { } public function complete(): Response { $this->takt->event('Signup', ['plan' => 'pro'], new Revenue('29.00', 'EUR')); $this->takt->pageview(); // ... } } ``` The autowired service is bound to the current request: it automatically attributes events to the request's IP address and User-Agent. > **Behind a proxy or load balancer?** The attributed IP comes from `Request::getClientIp()`. It only honours `X-Forwarded-For` when the request is trusted, so configure [`framework.trusted_proxies`](https://symfony.com/doc/current/deployment/proxies.html)for the real client IP. Without trusted proxies, clients can spoof the forwarded header — so never treat the attributed IP as authoritative. License ------- [](#license) MIT — see [LICENSE](LICENSE). ### Health Score 38 — LowBetter than 83% of packages Maintenance94 Actively maintained with recent releases Popularity8 Limited adoption so far Community6 Small or concentrated contributor base Maturity38 Early-stage or recently created project Bus Factor1 Top contributor holds 100% of commits — single point of failure How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** — Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~2 days Total 8 Last Release 27d ago ### Community Maintainers ![](https://avatars.githubusercontent.com/u/38018746?v=4)[Akayashuu](/maintainers/Akayashuu)[@Akayashuu](https://github.com/Akayashuu) --- Top Contributors [![Akayashuu](https://avatars.githubusercontent.com/u/38018746?v=4)](https://github.com/Akayashuu "Akayashuu (14 commits)") --- Tags analyticscookielessgdprphpprivacyprivacy-friendlyself-hostedsymfonytrackingtwigweb-analyticssymfonytwigtrackinganalyticsprivacytakt ### Code Quality TestsPHPUnit Static AnalysisPHPStan Code StylePHP CS Fixer Type Coverage Yes ### Embed Badge ![Health badge](/badges/vskstudio-takt-symfony/health.svg) ``` [![Health](https://phpackages.com/badges/vskstudio-takt-symfony/health.svg)](https://phpackages.com/packages/vskstudio-takt-symfony) ``` ### Alternatives [sulu/sulu Core framework that implements the functionality of the Sulu content management system 1.3k1.4M215](/packages/sulu-sulu)[shopware/platform The Shopware e-commerce core 3.4k1.5M3](/packages/shopware-platform)[shopware/core Shopware platform is the core for all Shopware ecommerce products. 585.6M605](/packages/shopware-core)[prestashop/prestashop PrestaShop is an Open Source e-commerce platform, committed to providing the best shopping cart experience for both merchants and customers. 9.2k18.1k](/packages/prestashop-prestashop)[web-auth/webauthn-framework FIDO2/Webauthn library for PHP and Symfony Bundle. 515100.5k3](/packages/web-auth-webauthn-framework)[contao/core-bundle Contao Open Source CMS 1231.6M2.9k](/packages/contao-core-bundle) PHPackages © 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)