PHPackages vskstudio/takt-laravel - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Templating & Views](/categories/templating) 4. / 5. vskstudio/takt-laravel ActiveLibrary[Templating & Views](/categories/templating) vskstudio/takt-laravel ====================== Laravel integration for Takt analytics: @takt Blade directive + Takt facade for server-side events. v0.5.0(3w ago)017MITPHPPHP >=8.1CI passing Since Jun 12Pushed 3w agoCompare [ Source](https://github.com/vskstudio/takt-laravel)[ Packagist](https://packagist.org/packages/vskstudio/takt-laravel)[ Docs](https://github.com/vskstudio/takt-laravel)[ RSS](/packages/vskstudio-takt-laravel/feed)WikiDiscussions main Synced 1w ago READMEChangelog (2)Dependencies (14)Versions (8)Used By (0) Takt for Laravel ================ [](#takt-for-laravel) Laravel integration for [Takt](https://github.com/vskstudio) analytics. Drop a single `@takt`Blade directive in your layout for privacy-friendly client-side tracking, and use the `Takt`facade to send server-side events straight from your application code. Requirements ------------ [](#requirements) - PHP 8.1+ - Laravel 10, 11, or 12 Installation ------------ [](#installation) ``` composer require vskstudio/takt-laravel ``` The service provider and the `Takt` facade are registered automatically through Laravel package auto-discovery. There is nothing else to wire up. Configuration ------------- [](#configuration) The package ships with sane defaults and reads everything from your environment. To customise the published config file: ``` php artisan vendor:publish --tag=takt-config ``` This writes `config/takt.php`. All values are environment-driven: Env variableDefaultDescription`TAKT_DOMAIN``''`The site/domain registered in Takt that data is attributed to.`TAKT_ENDPOINT``https://taktlytics.com`Base URL of your Takt ingest endpoint. Defaults to the hosted Takt origin.`TAKT_SCRIPT_ORIGIN``null`First-party origin to serve the tracker + derive the endpoint from (`{origin}/api/event`) — a custom domain you proxy through to dodge ad-blockers (endpoint wins over it).`TAKT_API_KEY``null`Ingest-scoped API key used for server-side events (see below).`TAKT_MODE``inline`Snippet delivery mode: `inline`, `cdn`, `asset`, or `sdk` (full ES-module `init()`, required for `TAKT_SCRUB_URL`).`TAKT_OUTBOUND``false`Track clicks on outbound links.`TAKT_FILES``false`Track file download clicks.`TAKT_FILE_EXTENSIONS``''`Comma-separated extensions to count as downloads (e.g. `pdf,zip,docx`). Empty keeps the tracker's default list.`TAKT_TAGGED``false`Track elements tagged in HTML with `data-takt-event`.`TAKT_NOT_FOUND``false`Track 404 pageviews.`TAKT_EXCLUDE_LOCALHOST``true`Skip tracking when running on localhost.`TAKT_NONCE``null`CSP nonce for the inline `` (request-scoped — see config notes).`TAKT_SAMPLE_RATE``null`Sample a fraction of hits, e.g. `0.5` keeps ~50%. Unset tracks everything.`TAKT_TRACK_QUERY``null`Keep the raw query string + hash in tracked URLs (default strips them).`TAKT_QUERY_PARAMS``''`Comma-separated query params to keep when `TAKT_TRACK_QUERY` is off (e.g. `utm_source,utm_medium`).`TAKT_EXCLUDE``''`Comma-separated path prefixes never tracked (e.g. `/app,/account`). Requires `TAKT_MODE=sdk`; segment-bounded.`TAKT_RESPECT_DNT``null`Set to `false` to stop honoring the browser Do-Not-Track header.`TAKT_ENABLED``null`Kill-switch: set to `false` to disable tracking entirely.`TAKT_SCRUB_URL``null`Raw JS function to rewrite URLs before sending, e.g. `(u) => u.split('#')[0]`. **Requires `TAKT_MODE=sdk` and is dev-controlled only** — it is injected verbatim into the page; never build it from user input.Example `.env`: ``` TAKT_DOMAIN=example.com TAKT_ENDPOINT=https://ingest.takt.io TAKT_API_KEY=ingest_xxxxxxxxxxxxxxxx TAKT_MODE=inline ``` Client-side tracking -------------------- [](#client-side-tracking) Add the `@takt` directive to the `` of your layout: ``` @takt @yield('content') ``` ### Delivery modes [](#delivery-modes) `TAKT_MODE` controls how the tracking script is delivered: - **`inline`** (default) — the script is embedded directly in the rendered HTML. Zero extra network requests, nothing to host. - **`cdn`** — references the script from the Takt CDN. - **`asset`** — references a self-hosted copy of the script served from your own application. - **`sdk`** — loads the full SDK as an ES module and boots it with `init()`. Required for `TAKT_SCRUB_URL` (custom URL rewriting), which cannot be expressed as a data attribute. Server-side events ------------------ [](#server-side-events) Use the `Takt` facade to record events from controllers, jobs, or anywhere in your application: ``` use Vskstudio\Takt\Laravel\Facades\Takt; use Vskstudio\Takt\Revenue; // A custom event with properties and revenue Takt::event('Signup', ['plan' => 'pro'], new Revenue('29.00', 'EUR')); // A simple pageview Takt::pageview(); ``` Server-side events automatically attribute to the current request's IP address and User-Agent, so they are correlated with the visitor that triggered them. You can optionally pass an explicit URL as the last argument to either method. > **API key scope:** `TAKT_API_KEY` must be an **ingest-scoped** key bound to the configured `TAKT_DOMAIN`. Keep it server-side only — it is never exposed to the browser. License ------- [](#license) MIT. See [LICENSE](LICENSE). ### Health Score 38 — LowBetter than 83% of packages Maintenance94 Actively maintained with recent releases Popularity8 Limited adoption so far Community6 Small or concentrated contributor base Maturity37 Early-stage or recently created project Bus Factor1 Top contributor holds 100% of commits — single point of failure How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** — Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~3 days Total 7 Last Release 27d ago ### Community Maintainers ![](https://avatars.githubusercontent.com/u/38018746?v=4)[Akayashuu](/maintainers/Akayashuu)[@Akayashuu](https://github.com/Akayashuu) --- Top Contributors [![Akayashuu](https://avatars.githubusercontent.com/u/38018746?v=4)](https://github.com/Akayashuu "Akayashuu (12 commits)") --- Tags analyticsbladecookielessgdprlaravelphpprivacyprivacy-friendlyself-hostedtrackingweb-analyticslaraveltrackingbladeanalyticsprivacytakt ### Code Quality TestsPHPUnit Static AnalysisPHPStan Code StyleLaravel Pint Type Coverage Yes ### Embed Badge ![Health badge](/badges/vskstudio-takt-laravel/health.svg) ``` [![Health](https://phpackages.com/badges/vskstudio-takt-laravel/health.svg)](https://phpackages.com/packages/vskstudio-takt-laravel) ``` ### Alternatives [craftcms/cms Craft CMS 3.6k3.6M3.2k](/packages/craftcms-cms)[roots/acorn Framework for Roots WordPress projects built with Laravel components. 9762.4M134](/packages/roots-acorn)[simplestats-io/laravel-client Server-side analytics for Laravel that follows the full funnel from visit to registration to payment, attributed to the channel that drove it. Revenue, MRR, churn and ad-spend profit (ROAS/CAC) per channel. GDPR compliant, ad-blocker proof. 5022.6k](/packages/simplestats-io-laravel-client)[hasinhayder/tyro-dashboard Tyro Dashboard - Beautiful admin dashboard for managing Tyro roles, privileges, users, and settings 5443.8k](/packages/hasinhayder-tyro-dashboard)[technikermathe/blade-lucide-icons A package to easily make use of Lucide icons in your Laravel Blade views. 18421.4k11](/packages/technikermathe-blade-lucide-icons)[eslazarev/wildberries-sdk Wildberries OpenAPI clients (generated). 293.1k](/packages/eslazarev-wildberries-sdk) PHPackages © 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)