PHPackages tenancy/tenancy - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Utility & Helpers](/categories/utility) 4. / 5. tenancy/tenancy ActiveLibrary[Utility & Helpers](/categories/utility) tenancy/tenancy =============== Creating multi tenant saas from your Laravel app with ease v2.5.0(1mo ago)1.3k46.2k↓59.1%92[6 issues](https://github.com/tenancy/tenancy/issues)[8 PRs](https://github.com/tenancy/tenancy/pulls)MITPHPCI failing Since May 12Pushed 1mo ago42 watchersCompare [ Source](https://github.com/tenancy/tenancy)[ Packagist](https://packagist.org/packages/tenancy/tenancy)[ GitHub Sponsors](https://github.com/sponsors/tenancy)[ OpenCollective](https://opencollective.com/tenancy)[ RSS](/packages/tenancy-tenancy/feed)WikiDiscussions 2.x Synced 2d ago READMEChangelog (10)Dependencies (13)Versions (36)Used By (0) [![Tenancy logo](https://avatars3.githubusercontent.com/u/33319474?s=25&v=4)](https://avatars3.githubusercontent.com/u/33319474?s=25&v=4) Tenancy Ecosystem (for Laravel) ========================================================================================================================================================================= [](#-tenancy-ecosystem-for-laravel) Enabling awesome Software as a Service with the Laravel framework. This is the successor of [hyn/multi-tenant](https://github.com/tenancy/multi-tenant). Feel free to show support by starring the project following progress via [twitter](https://twitter.com/tenancydev) and backing its development over at [OpenCollective](https://opencollective.com/tenancy) or [GitHub Sponsors](https://github.com/sponsors/tenancy). [![Tests](https://github.com/tenancy/tenancy/actions/workflows/tests.yaml/badge.svg)](https://github.com/tenancy/tenancy/actions/workflows/tests.yaml/badge.svg) [![Code Coverage](https://camo.githubusercontent.com/3484c3cec69487b1c92d0a429a256c2f65ea7fea6b3a8bde0ba48e6d51411403/68747470733a2f2f636f6465636f762e696f2f67682f74656e616e63792f74656e616e63792f6272616e63682f6d61737465722f67726170682f62616467652e737667)](https://codecov.io/gh/tenancy/tenancy)[![Subsplit](https://github.com/tenancy/tenancy/workflows/Subsplit/badge.svg)](https://github.com/tenancy/tenancy/workflows/Subsplit/badge.svg) > Before you start, we highly recommend you to read the extensive [online documentation](https://tenancy.dev/docs/tenancy/2.x). Installation ============ [](#installation) To give this package a spin, install all components at once: ``` $ composer require tenancy/tenancy ``` Otherwise make sure to selectively install the components you need and at least the framework: ``` $ composer require tenancy/framework ``` After that you'll need to decide on and configure: - [Database drivers](https://tenancy.dev/docs/tenancy/2.x/database-drivers) - [Identification drivers](https://tenancy.dev/docs/tenancy/2.x/identification-drivers) - [Affects](https://tenancy.dev/docs/tenancy/2.x/affects) - [Hooks](https://tenancy.dev/docs/tenancy/2.x/hooks) Contributions ============= [](#contributions) This repository is used for developing all tenancy packages. Contributors need to use this repository for implementing code. All other repositories are READ-ONLY and overwritten on each subsplit push. Please read our [Governance documentation](https://tenancy.dev/docs/governance/tenancy) in case you'd like to get involved. Local Testing ------------- [](#local-testing) Testing the ecosystem locally is possible when: - You have Docker (and docker-compose) installed - You have Bash installed When you have those requirements, you can simply run `./test` in order to run the test in Docker containers. By default they will run the most recent versions of all our dependencies ### Health Score 65 — FairBetter than 99% of packages Maintenance92 Actively maintained with recent releases Popularity55 Moderate usage in the ecosystem Community32 Small or concentrated contributor base Maturity68 Established project with proven stability Bus Factor1 Top contributor holds 57.5% of commits — single point of failure How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** — Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~96 days Total 24 Last Release 33d ago Major Versions 1.x-dev → v2.0.02022-06-16 ### Community Maintainers ![](https://www.gravatar.com/avatar/6141a177566f48e0d7d01d88f960e68ef42cdb87d903f6d7ddff17d985435e0e?d=identicon)[fletch3555](/maintainers/fletch3555) ![](https://avatars.githubusercontent.com/u/37894143?v=4)[Arlon Antonius](/maintainers/ArlonAntonius)[@ArlonAntonius](https://github.com/ArlonAntonius) --- Top Contributors [![ArlonAntonius](https://avatars.githubusercontent.com/u/37894143?v=4)](https://github.com/ArlonAntonius "ArlonAntonius (605 commits)")[![luceos](https://avatars.githubusercontent.com/u/504687?v=4)](https://github.com/luceos "luceos (363 commits)")[![fletch3555](https://avatars.githubusercontent.com/u/1387843?v=4)](https://github.com/fletch3555 "fletch3555 (45 commits)")[![sniper7kills](https://avatars.githubusercontent.com/u/5902574?v=4)](https://github.com/sniper7kills "sniper7kills (8 commits)")[![Plytas](https://avatars.githubusercontent.com/u/17316322?v=4)](https://github.com/Plytas "Plytas (8 commits)")[![dependabot[bot]](https://avatars.githubusercontent.com/in/29110?v=4)](https://github.com/dependabot[bot] "dependabot[bot] (5 commits)")[![bkintanar](https://avatars.githubusercontent.com/u/685928?v=4)](https://github.com/bkintanar "bkintanar (4 commits)")[![zhichao-poper](https://avatars.githubusercontent.com/u/141097055?v=4)](https://github.com/zhichao-poper "zhichao-poper (2 commits)")[![bretto36](https://avatars.githubusercontent.com/u/6217994?v=4)](https://github.com/bretto36 "bretto36 (2 commits)")[![mblarsen](https://avatars.githubusercontent.com/u/247048?v=4)](https://github.com/mblarsen "mblarsen (2 commits)")[![mgrom](https://avatars.githubusercontent.com/u/1607362?v=4)](https://github.com/mgrom "mgrom (1 commits)")[![morloderex](https://avatars.githubusercontent.com/u/5677808?v=4)](https://github.com/morloderex "morloderex (1 commits)")[![muglug](https://avatars.githubusercontent.com/u/2292638?v=4)](https://github.com/muglug "muglug (1 commits)")[![onwp](https://avatars.githubusercontent.com/u/49079271?v=4)](https://github.com/onwp "onwp (1 commits)")[![erikgaal](https://avatars.githubusercontent.com/u/1234268?v=4)](https://github.com/erikgaal "erikgaal (1 commits)")[![brianzzzasd](https://avatars.githubusercontent.com/u/33320494?v=4)](https://github.com/brianzzzasd "brianzzzasd (1 commits)")[![Tofandel](https://avatars.githubusercontent.com/u/6115458?v=4)](https://github.com/Tofandel "Tofandel (1 commits)")[![ajit-abc](https://avatars.githubusercontent.com/u/200740101?v=4)](https://github.com/ajit-abc "ajit-abc (1 commits)") --- Tags hacktoberfestlaravelmulti-tenantphpsaastenancylaravelawssaasmulti-tenanttenancygce ### Code Quality TestsPHPUnit Code StyleLaravel Pint ### Embed Badge ![Health badge](/badges/tenancy-tenancy/health.svg) ``` [![Health](https://phpackages.com/badges/tenancy-tenancy/health.svg)](https://phpackages.com/packages/tenancy-tenancy) ``` ### Alternatives [hyn/multi-tenant Run multiple websites using the same laravel installation while keeping tenant specific data separated for fully independant multi-domain setups. 2.6k1.2M9](/packages/hyn-multi-tenant)[backpack/crud Quickly build admin interfaces using Laravel, Bootstrap and JavaScript. 3.4k3.7M222](/packages/backpack-crud)[tenancy/framework Creating multi tenant saas from your Laravel app with ease 13246.2k42](/packages/tenancy-framework)[ronasit/laravel-helpers Provided helpers function and some helper class. 2085.6k31](/packages/ronasit-laravel-helpers)[dcat-plus/laravel-admin dcat-plus admin 1474.0k10](/packages/dcat-plus-laravel-admin)[ronasit/laravel-entity-generator Provided console command for generating entities. 2053.1k](/packages/ronasit-laravel-entity-generator) PHPackages © 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)