PHPackages                             tenancy/tenancy - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Utility &amp; Helpers](/categories/utility)
4. /
5. tenancy/tenancy

ActiveLibrary[Utility &amp; Helpers](/categories/utility)

tenancy/tenancy
===============

Creating multi tenant saas from your Laravel app with ease

v2.4.2(1y ago)1.3k43.6k↓10.7%95[11 PRs](https://github.com/tenancy/tenancy/pulls)MITPHPCI failing

Since May 12Pushed 5mo ago42 watchersCompare

[ Source](https://github.com/tenancy/tenancy)[ Packagist](https://packagist.org/packages/tenancy/tenancy)[ GitHub Sponsors](https://github.com/sponsors/tenancy)[ OpenCollective](https://opencollective.com/tenancy)[ RSS](/packages/tenancy-tenancy/feed)WikiDiscussions 2.x Synced 1mo ago

READMEChangelog (10)Dependencies (6)Versions (33)Used By (0)

[![Tenancy logo](https://avatars3.githubusercontent.com/u/33319474?s=25&v=4)](https://avatars3.githubusercontent.com/u/33319474?s=25&v=4) Tenancy Ecosystem (for Laravel)
=========================================================================================================================================================================

[](#-tenancy-ecosystem-for-laravel)

Enabling awesome Software as a Service with the Laravel framework.

This is the successor of [hyn/multi-tenant](https://github.com/tenancy/multi-tenant).

Feel free to show support by starring the project following progress via [twitter](https://twitter.com/tenancydev) and backing its development over at [OpenCollective](https://opencollective.com/tenancy) or [GitHub Sponsors](https://github.com/sponsors/tenancy).

[![Tests](https://github.com/tenancy/tenancy/actions/workflows/tests.yaml/badge.svg)](https://github.com/tenancy/tenancy/actions/workflows/tests.yaml/badge.svg)

[![Code Coverage](https://camo.githubusercontent.com/3484c3cec69487b1c92d0a429a256c2f65ea7fea6b3a8bde0ba48e6d51411403/68747470733a2f2f636f6465636f762e696f2f67682f74656e616e63792f74656e616e63792f6272616e63682f6d61737465722f67726170682f62616467652e737667)](https://codecov.io/gh/tenancy/tenancy)[![Subsplit](https://github.com/tenancy/tenancy/workflows/Subsplit/badge.svg)](https://github.com/tenancy/tenancy/workflows/Subsplit/badge.svg)

> Before you start, we highly recommend you to read the extensive [online documentation](https://tenancy.dev/docs/tenancy/2.x).

Installation
============

[](#installation)

To give this package a spin, install all components at once:

```
$ composer require tenancy/tenancy
```

Otherwise make sure to selectively install the components you need and at least the framework:

```
$ composer require tenancy/framework
```

After that you'll need to decide on and configure:

- [Database drivers](https://tenancy.dev/docs/tenancy/2.x/database-drivers)
- [Identification drivers](https://tenancy.dev/docs/tenancy/2.x/identification-drivers)
- [Affects](https://tenancy.dev/docs/tenancy/2.x/affects)
- [Hooks](https://tenancy.dev/docs/tenancy/2.x/hooks)

Contributions
=============

[](#contributions)

This repository is used for developing all tenancy packages.

Contributors need to use this repository for implementing code. All other repositories are READ-ONLY and overwritten on each subsplit push.

Please read our [Governance documentation](https://tenancy.dev/docs/governance/tenancy) in case you'd like to get involved.

Local Testing
-------------

[](#local-testing)

Testing the ecosystem locally is possible when:

- You have Docker (and docker-compose) installed
- You have Bash installed

When you have those requirements, you can simply run `./test` in order to run the test in Docker containers. By default they will run the most recent versions of all our dependencies

###  Health Score

56

—

FairBetter than 98% of packages

Maintenance61

Regular maintenance activity

Popularity54

Moderate usage in the ecosystem

Community32

Small or concentrated contributor base

Maturity67

Established project with proven stability

 Bus Factor1

Top contributor holds 57.6% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~82 days

Recently: every ~33 days

Total

23

Last Release

380d ago

Major Versions

1.x-dev → v2.0.02022-06-16

### Community

Maintainers

![](https://www.gravatar.com/avatar/6141a177566f48e0d7d01d88f960e68ef42cdb87d903f6d7ddff17d985435e0e?d=identicon)[fletch3555](/maintainers/fletch3555)

![](https://avatars.githubusercontent.com/u/37894143?v=4)[Arlon Antonius](/maintainers/ArlonAntonius)[@ArlonAntonius](https://github.com/ArlonAntonius)

---

Top Contributors

[![ArlonAntonius](https://avatars.githubusercontent.com/u/37894143?v=4)](https://github.com/ArlonAntonius "ArlonAntonius (605 commits)")[![luceos](https://avatars.githubusercontent.com/u/504687?v=4)](https://github.com/luceos "luceos (363 commits)")[![fletch3555](https://avatars.githubusercontent.com/u/1387843?v=4)](https://github.com/fletch3555 "fletch3555 (45 commits)")[![sniper7kills](https://avatars.githubusercontent.com/u/5902574?v=4)](https://github.com/sniper7kills "sniper7kills (8 commits)")[![Plytas](https://avatars.githubusercontent.com/u/17316322?v=4)](https://github.com/Plytas "Plytas (8 commits)")[![dependabot[bot]](https://avatars.githubusercontent.com/in/29110?v=4)](https://github.com/dependabot[bot] "dependabot[bot] (4 commits)")[![bkintanar](https://avatars.githubusercontent.com/u/685928?v=4)](https://github.com/bkintanar "bkintanar (4 commits)")[![zhichao-poper](https://avatars.githubusercontent.com/u/141097055?v=4)](https://github.com/zhichao-poper "zhichao-poper (2 commits)")[![mblarsen](https://avatars.githubusercontent.com/u/247048?v=4)](https://github.com/mblarsen "mblarsen (2 commits)")[![ajit-abc](https://avatars.githubusercontent.com/u/200740101?v=4)](https://github.com/ajit-abc "ajit-abc (1 commits)")[![mgrom](https://avatars.githubusercontent.com/u/1607362?v=4)](https://github.com/mgrom "mgrom (1 commits)")[![morloderex](https://avatars.githubusercontent.com/u/5677808?v=4)](https://github.com/morloderex "morloderex (1 commits)")[![muglug](https://avatars.githubusercontent.com/u/2292638?v=4)](https://github.com/muglug "muglug (1 commits)")[![onwp](https://avatars.githubusercontent.com/u/49079271?v=4)](https://github.com/onwp "onwp (1 commits)")[![brianzzzasd](https://avatars.githubusercontent.com/u/33320494?v=4)](https://github.com/brianzzzasd "brianzzzasd (1 commits)")[![bretto36](https://avatars.githubusercontent.com/u/6217994?v=4)](https://github.com/bretto36 "bretto36 (1 commits)")[![Tofandel](https://avatars.githubusercontent.com/u/6115458?v=4)](https://github.com/Tofandel "Tofandel (1 commits)")[![erikgaal](https://avatars.githubusercontent.com/u/1234268?v=4)](https://github.com/erikgaal "erikgaal (1 commits)")

---

Tags

hacktoberfestlaravelmulti-tenantphpsaastenancylaravelawssaasmulti-tenanttenancygce

###  Code Quality

TestsPHPUnit

### Embed Badge

![Health badge](/badges/tenancy-tenancy/health.svg)

```
[![Health](https://phpackages.com/badges/tenancy-tenancy/health.svg)](https://phpackages.com/packages/tenancy-tenancy)
```

###  Alternatives

[hyn/multi-tenant

Run multiple websites using the same laravel installation while keeping tenant specific data separated for fully independant multi-domain setups.

2.6k1.1M9](/packages/hyn-multi-tenant)[tenancy/framework

Creating multi tenant saas from your Laravel app with ease

13210.9k22](/packages/tenancy-framework)[ronasit/laravel-helpers

Provided helpers function and some helper class.

1475.7k13](/packages/ronasit-laravel-helpers)[sbine/simple-tenancy

Simple Laravel multi-tenancy in the same database

373.4k](/packages/sbine-simple-tenancy)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
