PHPackages                             sunucode/afripay - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Payment Processing](/categories/payments)
4. /
5. sunucode/afripay

ActiveLibrary[Payment Processing](/categories/payments)

sunucode/afripay
================

Unified payment gateway for Africa — Wave, Orange Money, PayDunya, PayTech, Stripe &amp; PayPal for Laravel

v1.0.1(3mo ago)079MITPHPPHP ^8.2

Since Mar 29Pushed 3mo agoCompare

[ Source](https://github.com/Sunucode/laravel-afripay)[ Packagist](https://packagist.org/packages/sunucode/afripay)[ RSS](/packages/sunucode-afripay/feed)WikiDiscussions main Synced 1w ago

READMEChangelog (1)Dependencies (14)Versions (3)Used By (0)

AfriPay - Unified Payment Gateway for Africa
============================================

[](#afripay---unified-payment-gateway-for-africa)

**Accept payments from Wave, Orange Money, PayDunya, PayTech, Stripe &amp; PayPal in your Laravel app with a single, clean API.**

[![Latest Version on Packagist](https://camo.githubusercontent.com/63bc9509540afcbd6cf3de21921d9cde51cfdd6bf2189b85d297eeb00c70c649/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f762f73756e75636f64652f616672697061792e737667)](https://packagist.org/packages/sunucode/afripay)[![License: MIT](https://camo.githubusercontent.com/784362b26e4b3546254f1893e778ba64616e362bd6ac791991d2c9e880a3a64e/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f4c6963656e73652d4d49542d677265656e2e737667)](LICENSE)[![PHP Version](https://camo.githubusercontent.com/d840cef9807c8f76051ad687841d67f4d830c84e0d83236968e53124ef6742d5/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f7068702d253345253344382e322d3838393242462e737667)](https://php.net)[![Laravel](https://camo.githubusercontent.com/5a05d3c9e420ab83f0af27d4cb7896ba703a8a6a7f0ad26ef6af052c8517b152/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f6c61726176656c2d3131253230253743253230313225323025374325323031332d4646324432302e737667)](https://laravel.com)

---

[Français](#francais) | [English](#english)

---

Français
--------

[](#français)

### Pourquoi AfriPay ?

[](#pourquoi-afripay-)

Les développeurs en Afrique de l'Ouest intègrent manuellement chaque passerelle de paiement dans chaque projet. Wave, Orange Money, PayDunya, PayTech... chacun avec son API, ses webhooks, ses signatures.

**AfriPay unifie tout ca en une seule interface :**

```
// Payer via Wave
$payment = AfriPay::via('wave')->charge([
    'amount'      => 15000,
    'currency'    => 'XOF',
    'description' => 'Abonnement Premium',
    'success_url' => route('payment.success'),
    'error_url'   => route('payment.error'),
]);

return redirect($payment['redirect_url']);
```

Changer de passerelle ? Une seule ligne :

```
AfriPay::via('stripe')->charge([...]);
AfriPay::via('paydunya')->charge([...]);
AfriPay::via('orange_money')->charge([...]);
```

### Passerelles supportées

[](#passerelles-supportées)

PasserellePaysTypeStatut**Wave**SN, CI, ML, BFMobile MoneyProduction**Orange Money**SN, CI, ML, BF, CM, GNMobile MoneyBeta**PayDunya**SN, CI, BJ, TG, BF, MLMulti-canalProduction**PayTech**SNMulti-canalProduction**Stripe**GlobalCarte bancaireProduction**PayPal**GlobalInternationalProduction### Installation

[](#installation)

```
composer require sunucode/afripay
```

#### Installation rapide (recommandé)

[](#installation-rapide-recommandé)

Une seule commande génère tout le nécessaire :

```
php artisan afripay:install
php artisan migrate
```

La commande crée :

- `config/afripay.php` — configuration des passerelles
- `app/Http/Controllers/AfriPayController.php` — controller avec `success()` et `error()`
- `resources/views/payment/{success,pending,error}.blade.php` — vues de retour (HTML simple, à intégrer dans votre layout)
- Les routes `/payment/success/{reference}` et `/payment/error/{reference}` dans `routes/web.php`
- Les event listeners dans `AppServiceProvider::boot()`

Par défaut, le controller est créé dans `app/Http/Controllers/`. Pour le placer ailleurs :

```
# Exemple : app/Http/Controllers/Payment/AfriPayController.php
php artisan afripay:install --controller-path=Http/Controllers/Payment
```

#### Installation manuelle

[](#installation-manuelle)

```
php artisan vendor:publish --tag=afripay-config
php artisan migrate
```

Puis suivez les sections [Écouter les événements](#%C3%A9couter-les-%C3%A9v%C3%A9nements-le-plus-important) et [Gestion du retour](#gestion-du-retour-success-url) ci-dessous.

### Configuration

[](#configuration)

Ajoutez vos clés dans `.env` :

```
# Passerelle par défaut
AFRIPAY_DEFAULT_GATEWAY=wave
AFRIPAY_CURRENCY=XOF

# Sécurité : seuls les webhooks peuvent confirmer un paiement (recommandé)
# Mettre à false en dev si les webhooks ne peuvent pas atteindre votre serveur
AFRIPAY_TRUST_WEBHOOK_ONLY=true

# Activer/désactiver les passerelles individuellement
AFRIPAY_WAVE_ENABLED=true
AFRIPAY_STRIPE_ENABLED=true
AFRIPAY_PAYDUNYA_ENABLED=true
AFRIPAY_PAYTECH_ENABLED=true
AFRIPAY_ORANGE_MONEY_ENABLED=false
AFRIPAY_PAYPAL_ENABLED=false

# Wave
WAVE_API_KEY=wave_sn_...
# WAVE_API_SECRET (signing secret) : OPTIONNEL
# Renseigner UNIQUEMENT si "Request Signing" est activé sur la clé API Wave.
# Si non activé, laisser vide.
WAVE_API_SECRET=
# WAVE_WEBHOOK_SECRET : OBLIGATOIRE en production si AFRIPAY_TRUST_WEBHOOK_ONLY=true
WAVE_WEBHOOK_SECRET=wave_sn_WHS_...

# Stripe
STRIPE_KEY=pk_test_...
STRIPE_SECRET=sk_test_...
STRIPE_WEBHOOK_SECRET=whsec_...

# PayDunya
PAYDUNYA_MASTER_KEY=...
PAYDUNYA_PRIVATE_KEY=...
PAYDUNYA_TOKEN=...
PAYDUNYA_MODE=test

# Orange Money
ORANGE_MONEY_CLIENT_ID=...
ORANGE_MONEY_CLIENT_SECRET=...
ORANGE_MONEY_MERCHANT_KEY=...

# PayPal
PAYPAL_CLIENT_ID=...
PAYPAL_CLIENT_SECRET=...
PAYPAL_MODE=sandbox

# PayTech
PAYTECH_API_KEY=...
PAYTECH_API_SECRET=...
PAYTECH_ENV=test
```

### Utilisation

[](#utilisation)

#### Initier un paiement

[](#initier-un-paiement)

```
use SunuCode\AfriPay\Facades\AfriPay;

$payment = AfriPay::via('wave')->charge([
    'amount'      => 25000,
    'currency'    => 'XOF',
    'description' => 'Commande #1234',
    'success_url' => route('orders.payment.success'),
    'error_url'   => route('orders.payment.error'),
    'metadata'    => [
        'order_id' => 1234,
        'user_id'  => auth()->id(),
    ],
]);

// $payment['redirect_url']  -> URL de paiement (rediriger l'utilisateur)
// $payment['transaction']   -> Instance Transaction (sauvegardée en DB)

return redirect($payment['redirect_url']);
```

#### Lier à un modèle (polymorphic)

[](#lier-à-un-modèle-polymorphic)

Passez `payable_type` et `payable_id` pour lier la transaction à n'importe quel modèle de votre application. C'est ce lien qui permet de router la logique métier dans vos listeners (voir section suivante).

```
// Abonnement
$payment = AfriPay::via('wave')->charge([
    'amount'        => 9900,
    'success_url'   => route('payment.success'),
    'error_url'     => route('payment.error'),
    'payable_type'  => Subscription::class,
    'payable_id'    => $subscription->id,
]);

// Commande e-commerce
$payment = AfriPay::via('paydunya')->charge([
    'amount'        => 25000,
    'success_url'   => route('payment.success'),
    'error_url'     => route('payment.error'),
    'payable_type'  => Order::class,
    'payable_id'    => $order->id,
]);

// Recharge de wallet (sans modèle lié)
$payment = AfriPay::via('orange_money')->charge([
    'amount'        => 5000,
    'success_url'   => route('payment.success'),
    'error_url'     => route('payment.error'),
    'metadata'      => ['user_id' => auth()->id(), 'type' => 'wallet_topup'],
]);
```

#### Écouter les événements (le plus important)

[](#écouter-les-événements-le-plus-important)

> **Important :** Laravel auto-découvre uniquement les listeners pour les events dans `App\Events\*`. Les events d'un package vendor comme AfriPay (`SunuCode\AfriPay\Events\*`) ne sont **jamais auto-découverts**. Vous devez les enregistrer manuellement.

Si vous avez utilisé `php artisan afripay:install`, les listeners sont déjà enregistrés avec des `// TODO` à compléter. Sinon, ajoutez-les dans `AppServiceProvider::boot()`.

**Cas simple** — une seule logique de paiement :

```
Event::listen(PaymentCompleted::class, function ($event) {
    $order = $event->transaction->payable;
    $order->markAsPaid();
});
```

**Cas courant** — plusieurs logiques (abonnement, commande, recharge...) :

Le `payable_type` que vous passez au `charge()` permet de router automatiquement vers la bonne logique. Utilisez `match()` sur le type polymorphique :

```
// app/Providers/AppServiceProvider.php

use Illuminate\Support\Facades\Event;
use SunuCode\AfriPay\Events\PaymentCompleted;
use SunuCode\AfriPay\Events\PaymentFailed;
use SunuCode\AfriPay\Events\PaymentRefunded;

public function boot(): void
{
    Event::listen(PaymentCompleted::class, function ($event) {
        $transaction = $event->transaction;
        $payable = $transaction->payable; // Le modèle lié (Order, Subscription...)

        match ($transaction->payable_type) {
            \App\Models\Subscription::class => $payable->activate(),
            \App\Models\Order::class        => $payable->markAsPaid(),
            default                         => $this->handleGenericPayment($transaction),
        };
    });

    Event::listen(PaymentFailed::class, function ($event) {
        $transaction = $event->transaction;

        match ($transaction->payable_type) {
            \App\Models\Order::class => $transaction->payable->cancel(),
            default                  => null,
        };

        // Notifier l'utilisateur dans tous les cas
        // Notification::send($transaction->payable?->user, new PaymentFailedNotification($transaction));
    });

    Event::listen(PaymentRefunded::class, function ($event) {
        // $event->reason contient le motif du remboursement
    });
}
```

**Avec des classes Listener dédiées** (recommandé pour les gros projets) :

```
Event::listen(PaymentCompleted::class, HandleCompletedPayment::class);
Event::listen(PaymentFailed::class, HandleFailedPayment::class);
```

#### Gestion du retour (success URL)

[](#gestion-du-retour-success-url)

Quand l'utilisateur est redirigé vers votre `success_url` après le paiement, le webhook n'est pas forcément encore arrivé. Vous **devez** appeler `verifyAndProcess()` dans votre controller de retour pour confirmer le paiement :

Si vous avez utilisé `php artisan afripay:install`, le controller est déjà généré avec cette logique. Sinon, voici le code à ajouter dans votre controller de retour :

```
use SunuCode\AfriPay\Facades\AfriPay;
use SunuCode\AfriPay\Models\Transaction as AfriPayTransaction;

public function success(string $reference)
{
    $transaction = AfriPayTransaction::where('reference', $reference)->firstOrFail();

    // Vérifie auprès de la passerelle ET dispatche PaymentCompleted si confirmé
    $transaction = AfriPay::verifyAndProcess($transaction);

    if ($transaction->status->isCompleted()) {
        return view('payment.success', compact('transaction'));
    }

    // Le paiement n'est pas encore confirmé (webhook en attente)
    return view('payment.pending', compact('transaction'));
}
```

> **Sans cet appel**, si le webhook arrive en retard (ou jamais en dev local), l'utilisateur verra une page de succès mais votre logique métier ne sera jamais exécutée.

#### Rembourser

[](#rembourser)

```
$transaction = AfriPay::refund($transaction, 'Client insatisfait');
// Dispatche PaymentRefunded
```

#### Lister les passerelles actives

[](#lister-les-passerelles-actives)

```
// Toutes les passerelles activées via .env
$gateways = AfriPay::enabledGateways();
// ['wave', 'stripe', 'paydunya', 'paytech']

// Vérifier si une passerelle est active
if (AfriPay::isEnabled('orange_money')) {
    // ...
}
```

#### Mode webhook-only vs fallback (trust\_webhook\_only)

[](#mode-webhook-only-vs-fallback-trust_webhook_only)

```
# PRODUCTION (recommandé) — seul le webhook peut confirmer un paiement
AFRIPAY_TRUST_WEBHOOK_ONLY=true

# DÉVELOPPEMENT — l'URL de retour peut aussi confirmer
AFRIPAY_TRUST_WEBHOOK_ONLY=false
```

Quand `trust_webhook_only=true`, `verifyAndProcess()` vérifie le statut auprès de la passerelle mais ne dispatche **aucun événement**. Seul le webhook déclenche `PaymentCompleted`. C'est plus sûr car ça empêche un utilisateur de forger une URL de succès.

⚠️ **Exigence de sécurité** : avec `trust_webhook_only=true`, configurez le secret webhook de chaque passerelle active (ex: `WAVE_WEBHOOK_SECRET`) ; sinon la confirmation de paiement par webhook ne pourra pas être validée.

Quand `trust_webhook_only=false`, les deux chemins (webhook ET URL de retour) peuvent déclencher les événements. Utile en dev local quand les webhooks ne peuvent pas atteindre votre machine.

> **Piège courant en développement :** Si vous développez en local sans tunnel (ngrok, Expose...), les webhooks ne peuvent pas atteindre votre machine. Avec `AFRIPAY_TRUST_WEBHOOK_ONLY=true` (défaut), `verifyAndProcess()` ne déclenchera **aucun event** et vos paiements resteront en `pending`.
>
> **Solution :** Mettez `AFRIPAY_TRUST_WEBHOOK_ONLY=false` dans votre `.env` local. N'oubliez pas de remettre `true` en production.

#### Ajouter une passerelle personnalisée

[](#ajouter-une-passerelle-personnalisée)

```
// Dans un ServiceProvider
use SunuCode\AfriPay\PaymentManager;

PaymentManager::extend('cinetpay', function (array $config) {
    return new CinetPayGateway($config);
});

// Utilisation
AfriPay::via('cinetpay')->charge([...]);
```

### Webhooks

[](#webhooks)

Les webhooks sont automatiquement enregistrés à :

```
POST /afripay/webhooks/wave
POST /afripay/webhooks/stripe
POST /afripay/webhooks/paydunya
POST /afripay/webhooks/orange-money
POST /afripay/webhooks/paytech
POST /afripay/webhooks/paypal

```

Le chemin est configurable via `AFRIPAY_WEBHOOK_PATH`.

**Chaque webhook :**

- Vérifie la signature (HMAC-SHA256 pour Wave/Stripe/PayTech, master\_key pour PayDunya)
- Vérifie le montant (tolérance +/- 1 unité)
- Utilise `lockForUpdate()` pour éviter les doublons
- Dispatche `PaymentCompleted` ou `PaymentFailed`

### Sécurité

[](#sécurité)

- **Idempotence** : Le champ `processed_at` empêche le double-traitement
- **Verrouillage DB** : `lockForUpdate()` sur chaque transaction pendant le webhook
- **Vérification de montant** : Tolérance +/- 1 unité avant d'accepter
- **Anti-replay** : Timestamps vérifiés (Wave, Stripe) avec tolérance de 5 min
- **Zero-decimal** : XOF/XAF gérés automatiquement (pas de x100 pour Stripe)
- **Orange Money** : Contre-vérification API obligatoire (pas de signature webhook)

### Événements disponibles

[](#événements-disponibles)

ÉvénementQuandDonnées`PaymentInitiated`Après `charge()``$transaction`, `$gateway``PaymentCompleted`Webhook confirmé`$transaction``PaymentFailed`Webhook échoué`$transaction``PaymentRefunded`Après `refund()``$transaction`, `$reason`---

English
-------

[](#english)

### Why AfriPay?

[](#why-afripay)

West African developers manually integrate each payment gateway in every project. Wave, Orange Money, PayDunya, PayTech... each with its own API, webhooks, and signatures.

**AfriPay unifies everything into a single interface:**

```
$payment = AfriPay::via('wave')->charge([
    'amount'      => 15000,
    'currency'    => 'XOF',
    'description' => 'Premium Subscription',
    'success_url' => route('payment.success'),
    'error_url'   => route('payment.error'),
]);

return redirect($payment['redirect_url']);
```

### Installation

[](#installation-1)

```
composer require sunucode/afripay

# Quick setup (recommended) — scaffolds controller, views, routes, and listeners
php artisan afripay:install
php artisan migrate
```

To place the controller in a custom directory:

```
php artisan afripay:install --controller-path=Http/Controllers/Payment
```

Or set up manually: `php artisan vendor:publish --tag=afripay-config` and follow the sections below.

### Listening to Events

[](#listening-to-events)

> **Important:** Laravel only auto-discovers listeners for events in `App\Events\*`. Events from a vendor package like AfriPay (`SunuCode\AfriPay\Events\*`) are **never auto-discovered**. You must register them manually.

If you used `php artisan afripay:install`, listeners are already registered with `// TODO` placeholders. Otherwise, add them in `AppServiceProvider::boot()`.

Use the `payable_type` set during `charge()` to route to the right business logic:

```
use Illuminate\Support\Facades\Event;
use SunuCode\AfriPay\Events\PaymentCompleted;
use SunuCode\AfriPay\Events\PaymentFailed;

public function boot(): void
{
    Event::listen(PaymentCompleted::class, function ($event) {
        $transaction = $event->transaction;
        $payable = $transaction->payable;

        match ($transaction->payable_type) {
            \App\Models\Subscription::class => $payable->activate(),
            \App\Models\Order::class        => $payable->markAsPaid(),
            default                         => null,
        };
    });

    Event::listen(PaymentFailed::class, function ($event) {
        // Notify user, log failure, etc.
    });
}
```

### Handling the Success URL

[](#handling-the-success-url)

When the user is redirected to your `success_url`, the webhook may not have arrived yet. You **must** call `verifyAndProcess()` in your return controller:

```
use SunuCode\AfriPay\Facades\AfriPay;
use SunuCode\AfriPay\Models\Transaction as AfriPayTransaction;

public function success(string $reference)
{
    $transaction = AfriPayTransaction::where('reference', $reference)->firstOrFail();
    $transaction = AfriPay::verifyAndProcess($transaction);

    if ($transaction->status->isCompleted()) {
        return view('payment.success', compact('transaction'));
    }

    return view('payment.pending', compact('transaction'));
}
```

### AFRIPAY\_TRUST\_WEBHOOK\_ONLY

[](#afripay_trust_webhook_only)

> **Common pitfall in development:** Without a tunnel (ngrok, Expose...), webhooks can't reach your local machine. With `AFRIPAY_TRUST_WEBHOOK_ONLY=true` (default), `verifyAndProcess()` will **not dispatch any events** and your payments will stay `pending`.
>
> **Fix:** Set `AFRIPAY_TRUST_WEBHOOK_ONLY=false` in your local `.env`. Remember to set it back to `true` in production.

### Custom Gateways

[](#custom-gateways)

Extend AfriPay with your own gateways:

```
use SunuCode\AfriPay\Contracts\GatewayInterface;
use SunuCode\AfriPay\PaymentManager;

class CinetPayGateway implements GatewayInterface
{
    // Implement the 4 methods: charge(), handleWebhook(), verify(), verifySignature()
}

PaymentManager::extend('cinetpay', fn($config) => new CinetPayGateway($config));
```

### Security

[](#security)

- **Idempotent processing** via atomic `processed_at` flag
- **Database locking** (`lockForUpdate`) prevents race conditions
- **Amount verification** with configurable tolerance
- **Replay protection** with timestamp validation (Wave, Stripe)
- **Zero-decimal currencies** (XOF, XAF) handled automatically
- **Orange Money**: Mandatory API counter-verification (no webhook signature)

---

Requirements
------------

[](#requirements)

- PHP &gt;= 8.2
- Laravel 11, 12, or 13
- A database supporting `lockForUpdate()` (MySQL, PostgreSQL)

Contributing
------------

[](#contributing)

Contributions are welcome! Please submit pull requests to the `main` branch.

Credits
-------

[](#credits)

- Built by [Sunu Code](https://sunucode.com) — Software agency based in Dakar, Senegal
- Extracted from [Semplio](https://semplio.com) — Business management SaaS for African SMEs

License
-------

[](#license)

MIT License. See [LICENSE](LICENSE) for details.

###  Health Score

39

—

LowBetter than 84% of packages

Maintenance81

Actively maintained with recent releases

Popularity13

Limited adoption so far

Community6

Small or concentrated contributor base

Maturity48

Maturing project, gaining track record

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~34 days

Total

2

Last Release

101d ago

### Community

Maintainers

![](https://www.gravatar.com/avatar/b112190f7278156ffd6c602e373c7a14108c8649728fd05c0cfe26a01c266690?d=identicon)[Sunucode](/maintainers/Sunucode)

---

Top Contributors

[![Sunucode](https://avatars.githubusercontent.com/u/76840710?v=4)](https://github.com/Sunucode "Sunucode (8 commits)")

---

Tags

africafcfalaravellaravel-packagemobile-moneyorange-moneypaydunyapaymentpaypalpaytechsenegalstripewavexoflaravelstripepaymentpaypalmobile-moneyafricaOrange Moneypaydunyawavepaytechxoffcfa

###  Code Quality

TestsPest

### Embed Badge

![Health badge](/badges/sunucode-afripay/health.svg)

```
[![Health](https://phpackages.com/badges/sunucode-afripay/health.svg)](https://phpackages.com/packages/sunucode-afripay)
```

###  Alternatives

[psalm/plugin-laravel

Psalm plugin for Laravel

3345.4M354](/packages/psalm-plugin-laravel)[laravel/cashier

Laravel Cashier provides an expressive, fluent interface to Stripe's subscription billing services.

2.6k31.8M158](/packages/laravel-cashier)[pressbooks/pressbooks

Pressbooks is an open source book publishing tool built on a WordPress multisite platform. Pressbooks outputs books in multiple formats, including PDF, EPUB, web, and a variety of XML flavours, using a theming/templating system, driven by CSS.

45844.8k1](/packages/pressbooks-pressbooks)[api-platform/laravel

API Platform support for Laravel

58190.1k21](/packages/api-platform-laravel)[forjedio/inertia-table

Backend-driven dynamic tables for Laravel + Inertia.js

272.0k](/packages/forjedio-inertia-table)[simplestats-io/laravel-client

Server-side analytics for Laravel that follows the full funnel from visit to registration to payment, attributed to the channel that drove it. Revenue, MRR, churn and ad-spend profit (ROAS/CAC) per channel. GDPR compliant, ad-blocker proof.

5226.7k](/packages/simplestats-io-laravel-client)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
