PHPackages                             prgayman/larafcm - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [API Development](/categories/api)
4. /
5. prgayman/larafcm

ActiveLibrary[API Development](/categories/api)

prgayman/larafcm
================

Laravel Firebase Cloud Messaging

1.0.4(3y ago)55.7k↓56.7%1MITPHPPHP ^7.2.5|^8.0|^8.1

Since Feb 19Pushed 3y ago1 watchersCompare

[ Source](https://github.com/prgayman/larafcm)[ Packagist](https://packagist.org/packages/prgayman/larafcm)[ Docs](https://github.com/prgayman/larafcm)[ RSS](/packages/prgayman-larafcm/feed)WikiDiscussions main Synced 2w ago

READMEChangelog (5)Dependencies (4)Versions (5)Used By (0)

Laravel Firebase Cloud Messaging
================================

[](#laravel-firebase-cloud-messaging)

Introduction
------------

[](#introduction)

LaraFcm is an easy to use package working with both Laravel and Lumen for sending push notification with [Firebase Cloud Messaging](https://firebase.google.com/docs/cloud-messaging/) (FCM).

Installation
------------

[](#installation)

To get the latest version of LaraFcm on your project, require it from "composer":

```
$ composer require prgayman/larafcm

```

Or you can add it directly in your composer.json file:

```
{
  "require": {
    "prgayman/larafcm": "1.0.0"
  }
}
```

Publish the package config and migrations files using the following command:

```
$ php artisan vendor:publish --provider="Prgayman\LaraFcm\Providers\LaraFcmServiceProvider"

```

migrate larafcm\_tokens using the following command:

```
$ php artisan migrate

```

### Laravel

[](#laravel)

Register the provider directly in your app configuration file config/app.php `config/app.php`:

Laravel &gt;= 5.5 provides package auto-discovery, thanks to rasmuscnielsen and luiztessadri who help to implement this feature in LaraFcm, the registration of the provider and the facades should not be necessary anymore.

```
'providers' => [
    Prgayman\LaraFcm\Providers\LaraFcmServiceProvider::class,
]
```

Add the facade aliases in the same file:

```
'aliases' => [

  'LaraFcm' => Prgayman\LaraFcm\Facades\LaraFcm::class,

]
```

### Lumen

[](#lumen)

Register the provider in your bootstrap app file `boostrap/app.php`

Add the following line in the "Register Service Providers" section at the bottom of the file.

```
$app->register(Prgayman\LaraFcm\Providers\LaraFcmServiceProvider::class);
```

For facades, add the following lines in the section "Create The Application" .

```
class_alias(\Prgayman\LaraFcm\Facades\LaraFcm::class, 'LaraFcm');
```

### Package Configuration

[](#package-configuration)

In your `.env` file, add the server key and the secret key for the Firebase Cloud Messaging:

```
LARAFCM_AUTHENTICATION_KEY=my_secret_server_key
LARAFCM_SENDER_ID=my_secret_sender_id
```

To get these keys, you must create a new application on the [firebase cloud messaging console](https://console.firebase.google.com/).

After the creation of your application on Firebase, you can find keys in `project settings -> cloud messaging`.

Usage
-----

[](#usage)

Two types of messages can be sent using LaraFcm:

- Notification messages, sometimes thought of as "display messages"
- Data messages, which are handled by the client app

More information is available in the [official documentation](https://firebase.google.com/docs/cloud-messaging/concept-options).

### Larafcm tokens manager (Prgayman\\LaraFcm\\Services\\LaraFcmToken)

[](#larafcm-tokens-manager-prgaymanlarafcmserviceslarafcmtoken)

```
use Prgayman\LaraFcm\Services\LaraFcmToken;

// Store desvice token
(new LaraFcmToken)
->setTokens(['token'])
->store();

// Store desvice token to specific user
(new LaraFcmToken)
->setTokens('token')
->setModel(User::find(1))
->store();

// Can you set platform or locale to token both options is optional
(new LaraFcmToken)
->setTokens(['token'])
->setPlatform('android')
->setLocale('en')
->store();

/**
 * Get token from database you can use filter by model or locale ot platform to get tokens
 *
 * @param Illuminate\Database\Eloquent\Model|null $model
 * @param string|null $locale
 * @param string|null $platform
 *
 * @return array
 */
$tokens = LaraFcmToken::getDbTokens();

$removeTokens = [];
/**
 * Remove toknes from database
 * @param array $tokens
 *
 * @return bool
*/
$isDeleted = LaraFcmToken::removeDbTokens($removeTokens);
```

### Larafcm trait HasLaraFcm (Prgayman\\LaraFcm\\Traits\\HasLaraFcm)

[](#larafcm-trait-haslarafcm-prgaymanlarafcmtraitshaslarafcm)

```
use Illuminate\Foundation\Auth\User as Authenticatable;
use Prgayman\LaraFcm\Traits\HasLaraFcm; // Add this line

class User extends Authenticatable
{
    use HasLaraFcm; // Add this line
}

$user = User::find(1);

/**
 * Get user tokens can you use filter by locale or platform
 *
 * @param string|null $locale
 * @param string|null $platform
 *
 * @return array
 */
$locale = null;
$platform = "ios";
$userTokens = $user->larafcmGetTokens($locale,$platform)

/**
 * store user tokens can you set platform or locale to token
 *
 * @param array|string $tokens
 * @param string|null  $locale
 * @param string|null  $platform
 *
 * @return bool
 */
$storeUserTokens = ['new_token'];
$user->larafcmStoreTokens($tokens, $locale, $platform)
```

### Downstream Messages

[](#downstream-messages)

A downstream message is a notification message, a data message, or both, that you send to a target device or to multiple target devices using its registration\_Ids.

The following use statements are required for the examples below:

```
use Prgayman\LaraFcm\Message\Options;
use Prgayman\LaraFcm\Message\Data;
use Prgayman\LaraFcm\Message\Notification;
use Prgayman\LaraFcm\Message\Topics;
use LaraFcm;
```

#### Sending a Downstream Message to a Device

[](#sending-a-downstream-message-to-a-device)

```
// Get all tokens form database return array you can set string token
$tokens = LaraFcmToken::getDbTokens();

// Send Notifications without data
$downstreamResponse = LaraFcm::to($tokens)
notification(
    (new Notification)
        ->setTitle('New Order')
        ->setBody('You have placed order')
        ->setColor('#f00')
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->send();

// Send Notifications with data
$downstreamResponse = LaraFcm::to($tokens)
notification(
    (new Notification)
        ->setTitle('New Order')
        ->setBody('You have placed order')
        ->setColor('#f00')
)
->data(
    (new Data)
    ->addData(['key'=>"value"])
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->send();

// Send data message
$downstreamResponse = LaraFcm::to($tokens)
->data(
    (new Data)
    ->addData(['key'=>"value"])
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->send();

$downstreamResponse->numberSuccess();
$downstreamResponse->numberFailure();
$downstreamResponse->numberModification();

// return Array - you must remove all this tokens in your database
$downstreamResponse->tokensToDelete();

// return Array (key : oldToken, value : new token - you must change the token in your database)
$downstreamResponse->tokensToModify();

// return Array - you should try to resend the message to the tokens in the array
$downstreamResponse->tokensToRetry();

// return Array (key:token, value:error) - in production you should remove from your database the tokens
$downstreamResponse->tokensWithError();
```

> Kindly refer [Downstream message error response codes](https://firebase.google.com/docs/cloud-messaging/http-server-ref#error-codes) documentation for more information.

#### Sending a Message to a Topic

[](#sending-a-message-to-a-topic)

```
$topicResponse = LaraFcm::notification(
    (new Notification)
        ->setTitle('New Order')
        ->setBody('You have placed order')
        ->setColor('#f00')
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->topics(
    (new Topics)
    ->topic('larafcm')
)
->send();

$topicResponse->isSuccess();
$topicResponse->shouldRetry();
$topicResponse->error();
```

#### Sending a Message to Multiple Topics

[](#sending-a-message-to-multiple-topics)

It sends notification to devices registered at the following topics:

- larafcm and ecommerce
- larafcm and news

> Note : Conditions for topics support two operators per expression

```
$topicResponse = LaraFcm::notification(
    (new Notification)
        ->setTitle('New Order')
        ->setBody('You have placed order')
        ->setColor('#f00')
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->topics(
    (new Topics)
    ->topic('larafcm')
    ->andTopic(function($condition) {
	    $condition->topic('ecommerce')->orTopic('news');
    });
)
->send();

$topicResponse->isSuccess();
$topicResponse->shouldRetry();
$topicResponse->error());
```

Options
-------

[](#options)

LaraFcm supports options based on the options of Firebase Cloud Messaging. These options can help you to define the specificity of your notification.

You can construct an option as follows:

```
use Prgayman\LaraFcm\Message\Options;

$options = new Options;
$options->setTimeToLive(42*60)
        ->setCollapseKey('a_collapse_key');
```

Notification Messages
---------------------

[](#notification-messages)

Notification payload is used to send a notification, the behaviour is defined by the App State and the OS of the receptor device.

**Notification messages are delivered to the notification tray when the app is in the background.** For apps in the foreground, messages are handled by these callbacks:

- didReceiveRemoteNotification: on iOS
- onMessageReceived() on Android. The notification key in the data bundle contains the notification.

See the [official documentation](https://firebase.google.com/docs/cloud-messaging/concept-options#notifications).

```
use Prgayman\LaraFcm\Message\Notification;
$notification = new Notification();
$notification->setTitle('title')
             ->setBody('body')
             ->setSound('sound')
             ->setBadge('badge');
```

Notification &amp; Data Messages
--------------------------------

[](#notification--data-messages)

App behavior when receiving messages that include both notification and data payloads depends on whether the app is in the background or the foreground—essentially, whether or not it is active at the time of receipt ([source](https://firebase.google.com/docs/cloud-messaging/concept-options#messages-with-both-notification-and-data-payloads)).

- **Background**, apps receive notification payload in the notification tray, and only handle the data payload when the user taps on the notification.
- **Foreground**, your app receives a message object with both payloads available.

Topics
------

[](#topics)

For topics message, LaraFcm offers an easy to use api which abstract firebase conditions. To make the condition given for example in the firebase official documentation it must be done with LaraFcm like below:

**Official documentation condition**

```
'TopicA' in topics && ('TopicB' in topics || 'TopicC' in topics)

```

```
use Prgayman\LaraFcm\Message\Topics;

$topics = new Topics;
$topics->topic('TopicA')
       ->andTopic(function($condition) {
	       $condition->topic('TopicB')->orTopic('TopicC');
       });
```

Helper fucntions
----------------

[](#helper-fucntions)

### larafcm()

[](#larafcm)

```
$topicResponse = larafcm()
->notification(
    (new Notification)
        ->setTitle('New Order')
        ->setBody('You have placed order')
        ->setColor('#f00')
)
->options(
    (new Options)
    ->setTimeToLive(60*20)
    ->setContentAvailable(true)
)
->data(
    (new Data)
    ->addData(['key'=>"value"])
)
->topics(
    (new Topics)
    ->topic('larafcm')
)
->send();
```

Laravel Notification channel
----------------------------

[](#laravel-notification-channel)

```
use Illuminate\Notifications\Notification;
use  Prgayman\LaraFcm\Services\LaraFcm;

use Prgayman\LaraFcm\Message\Data;
use Prgayman\LaraFcm\Message\Notification as LaraFcmNotification;
use Prgayman\LaraFcm\Message\Options;

class SendPlacedOrder extends Notification
{
    public function via($notifiable)
    {
        return ['larafcm'];
    }

    public function toLaraFcm($notifiable)
    {
        $tokens = ['TOKEN_1','TOKEN_2'];

        return (new LaraFcm)
        ->notification(
            (new LaraFcmNotification)
                ->setTitle('New Order')
                ->setBody('You have placed order')
                ->setColor('#f00')
        )
        ->options(
            (new Options)
            ->setTimeToLive(60*20)
            ->setContentAvailable(true)
        )
        ->data(
            (new Data)
            ->addData(['key'=>"value"])
        )
        ->to($tokens)
        ->send();
    }
}
```

Licence
-------

[](#licence)

This library is open-sourced software licensed under the [MIT license](http://opensource.org/licenses/MIT).

Some of this documentation is coming from the official documentation. You can find it completely on the [Firebase Cloud Messaging](https://firebase.google.com/docs/cloud-messaging/) Website.

###  Health Score

34

—

LowBetter than 74% of packages

Maintenance20

Infrequent updates — may be unmaintained

Popularity27

Limited adoption so far

Community8

Small or concentrated contributor base

Maturity65

Established project with proven stability

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~291 days

Total

4

Last Release

1133d ago

PHP version history (2 changes)1.0.0PHP ^7.2.5|^8.0

1.0.4PHP ^7.2.5|^8.0|^8.1

### Community

Maintainers

![](https://www.gravatar.com/avatar/a58ac9d97c7512d26d3399236df1329b0483e1c5d5cfc01e0dccb1437f03faaa?d=identicon)[aymanalaiwah](/maintainers/aymanalaiwah)

---

Top Contributors

[![prgayman](https://avatars.githubusercontent.com/u/62302022?v=4)](https://github.com/prgayman "prgayman (28 commits)")

---

Tags

laravelfirebaseFCMprgaymanlarafcm

### Embed Badge

![Health badge](/badges/prgayman-larafcm/health.svg)

```
[![Health](https://phpackages.com/badges/prgayman-larafcm/health.svg)](https://phpackages.com/packages/prgayman-larafcm)
```

###  Alternatives

[craftcms/cms

Craft CMS

3.6k3.7M3.4k](/packages/craftcms-cms)[laravel/framework

The Laravel Framework.

34.9k556.2M21.5k](/packages/laravel-framework)[spatie/laravel-health

Monitor the health of a Laravel application

88212.7M188](/packages/spatie-laravel-health)[tempest/framework

The PHP framework that gets out of your way.

2.3k37.6k21](/packages/tempest-framework)[simplestats-io/laravel-client

Server-side analytics for Laravel that follows the full funnel from visit to registration to payment, attributed to the channel that drove it. Revenue, MRR, churn and ad-spend profit (ROAS/CAC) per channel. GDPR compliant, ad-blocker proof.

5226.7k](/packages/simplestats-io-laravel-client)[fleetbase/core-api

Core Framework and Resources for Fleetbase API

1239.7k25](/packages/fleetbase-core-api)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
