PHPackages                             mrizwan/laravel-fcgi-client - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [HTTP &amp; Networking](/categories/http)
4. /
5. mrizwan/laravel-fcgi-client

ActiveLibrary[HTTP &amp; Networking](/categories/http)

mrizwan/laravel-fcgi-client
===========================

A Laravel package for communicating with FastCGI-compatible servers (like PHP-FPM)

v1.1.0(10mo ago)2155MITPHPPHP ^8.1

Since May 21Pushed 10mo ago1 watchersCompare

[ Source](https://github.com/muhammad-rizwan/laravel-fcgi-client)[ Packagist](https://packagist.org/packages/mrizwan/laravel-fcgi-client)[ Docs](https://github.com/muhammad-rizwan/laravel-fcgi-client)[ RSS](/packages/mrizwan-laravel-fcgi-client/feed)WikiDiscussions main Synced 1mo ago

READMEChangelog (3)Dependencies (5)Versions (10)Used By (0)

Laravel FastCGI Client
======================

[](#laravel-fastcgi-client)

A modern, Laravel-style FastCGI client that lets your Laravel application communicate directly with FastCGI-compatible servers like PHP-FPM.

The package works similarly to Laravel's HTTP Facade

Acknowledgements
----------------

[](#acknowledgements)

This package is built as a fork of the [fast-cgi-client](https://github.com/hollodotme/fast-cgi-client) library originally authored by **hollodotme**. We've adapted and extended it to provide seamless integration with Laravel—many thanks to the original author for creating such a solid foundation.

What is FastCGI?
----------------

[](#what-is-fastcgi)

FastCGI is a protocol that allows a web server (like Nginx or Apache) to communicate with external applications, typically programming language interpreters like PHP-FPM (PHP FastCGI Process Manager). It's an improvement over the older CGI protocol, offering better performance through persistent processes.

In a traditional PHP web application setup, the web server (e.g., Nginx) receives HTTP requests and forwards them to PHP-FPM via FastCGI, which then executes the PHP scripts and returns the results.

Where This Package Can Be Used
------------------------------

[](#where-this-package-can-be-used)

This package enables Laravel applications to directly communicate with PHP-FPM, which opens up several use cases:

1. **Microservices Architecture**: Directly communicate with other PHP-based microservices without going through HTTP, reducing overhead.
2. **Private API Access**: Access internal APIs on remote servers via FastCGI instead of exposing them through HTTP endpoints.
3. **Cross-Application Communication**: Call scripts on another PHP application from your Laravel app with lower latency than HTTP requests.
4. **Gateway/Proxy Services**: Create gateway services that can route requests to appropriate backend PHP services.

🚀 Installation
--------------

[](#-installation)

```
composer require mrizwan/laravel-fcgi-client
```

🔧 Configuration
---------------

[](#-configuration)

The package automatically registers the service provider and facade in Laravel 9.x and above.

You can use the facade in your code by importing it:

```
use Rizwan\LaravelFcgiClient\Facades\FCGI;
```

✅ Basic Usage
-------------

[](#-basic-usage)

- The URL must **NOT** include the protocol.
    - E.g.: `example-domain.com/example-endpoint`

### Simple GET Request

[](#simple-get-request)

```
$response = FCGI::get('remote-server.com/api/products', ['category' => 'electronics']);

// Handle the response
$data = $response->json();
$statusCode = $response->getStatusCode();
```

### POST Request with Data

[](#post-request-with-data)

```
$response = FCGI::post('123.321.123.321/api/products', [
        'name' => 'New Product',
        'price' => 99.99,
        'category' => 'electronics'
    ]);

// Check if the request was successful
if ($response->successful()) {
    $newProduct = $response->json();
    echo "Created product with ID: " . $newProduct['id'];
}
```

### JSON Request

[](#json-request)

```
$response = FCGI::asJson()
    ->post('auth-service.internal/api/users', [
        'user' => [
            'name' => 'John Doe',
            'email' => 'john@example.com'
        ]
    ]);
```

### Defaults:

[](#defaults)

- Script path: `/var/www/public/index.php`
- Port: 9000

📡 Available Methods
-------------------

[](#-available-methods)

### HTTP Methods

[](#http-methods)

All HTTP methods support Laravel-like signatures with optional data arrays:

- `get(string $url, array $query = [])`
- `post(string $url, array $data = [])`
- `put(string $url, array $data = [])`
- `patch(string $url, array $data = [])`
- `delete(string $url, array $data = [])`

### Request Configuration

[](#request-configuration)

```
// Change FCGI Script Path
FCGI::scriptPath('var/www/html/api/public/index.php');
```

```
// Change FCGI Port
FCGI::port(9003);
```

```
// Add HTTP headers
FCGI::withHeaders([
    'Authorization' => 'Bearer your-token',
    'Accept-Language' => 'en-US'
]);

// Add a single header
FCGI::withHeader('X-API-Key', 'secret-key');

// Add query parameters (for GET requests or as method parameter)
FCGI::withQuery([
    'page' => 1,
    'limit' => 20,
    'sort' => 'created_at'
]);

// Add request payload (for POST, PUT, PATCH requests)
FCGI::withPayload([
    'name' => 'Product Name',
    'description' => 'Product description'
]);

// Set raw body content with content type
FCGI::withBody(
    '{"custom":"json structure"}',
    'application/json'
);

// Set URL parameters for template substitution
FCGI::withUrlParameters([
    'userId' => 123,
    'postId' => 456,
    'user' => ['id' => 789] // Supports nested parameters
]);

// Add custom server parameters that will be available in $_SERVER
FCGI::withServerParams([
    'HTTP_X_CUSTOM_HEADER' => 'Value',
    'SERVER_NAME' => 'custom-server'
]);

// Add custom FastCGI variables
FCGI::withCustomVars([
    'CUSTOM_VAR' => 'custom_value'
]);

// Set connection timeouts (in seconds)
FCGI::timeout(30);        // Read timeout
FCGI::connectTimeout(5);  // Connect timeout

// Add retry logic
FCGI::retry(
    3,                      // Number of retries
    500,                    // Delay between retries in milliseconds
    function ($exception) { // Optional callback to determine whether to retry
        return !($exception instanceof AuthenticationException);
    }
);
```

### Content Type Configuration

[](#content-type-configuration)

```
// Configure request to send JSON payload
FCGI::asJson()
    ->post('service.com/doSomething', ['key' => 'value']);

// Configure request to send form-encoded data
FCGI::asForm()
    ->post('service.com/doSomethingElse', ['key' => 'value']);

// Set Accept header to JSON
FCGI::acceptJson();

// Set Accept header to specific content type
FCGI::accept('application/xml');

// Set custom content type
FCGI::contentType('application/vnd.api+json');
```

### Authentication

[](#authentication)

```
// Bearer token authentication
FCGI::withToken('your-jwt-token')
    ->get('api.example.com/protected/endpoint');

// Custom token type
FCGI::withToken('api-key-123', 'ApiKey')
    ->get('api.example.com/protected/endpoint');

// Basic authentication
FCGI::withBasicAuth('username', 'password')
    ->get('api.example.com/protected/endpoint');

// Custom User-Agent
FCGI::withUserAgent('MyApp/1.0')
    ->get('api.example.com/endpoint');
```

Method Chaining
---------------

[](#method-chaining)

You can chain multiple methods together for cleaner code:

```
$response = FCGI::withHeaders(['X-API-Key' => 'secret-key'])
    ->withUrlParameters(['userId' => 123])
    ->withQuery(['include' => 'profile'])
    ->timeout(10)
    ->retry(3, 1000)
    ->get('user-service.internal/api/v1/users/{userId}');
```

🔗 URL Templates
---------------

[](#-url-templates)

The package supports URL templates with parameter substitution:

```
// Simple parameter substitution
$response = FCGI::withUrlParameters(['id' => 123])
    ->get('api.example.com/api/users/{id}');
// Results in: /api/users/123

// Nested parameter support
$response = FCGI::withUrlParameters([
        'user' => ['id' => 123],
        'post' => ['id' => 456]
    ])
    ->get('api.example.com/api/users/{user.id}/posts/{post.id}');
// Results in: /api/users/123/posts/456

// Parameters not found remain as placeholders
$response = FCGI::withUrlParameters(['existing' => 'value'])
    ->get('api.example.com/api/{missing}/endpoint');
// Results in: /api/{missing}/endpoint
```

🌐 Response API
--------------

[](#-response-api)

The response object provides a rich API similar to Laravel's HTTP client:

```
$response = FCGI::get('api.example.com/endpoint');

// Status code and state checks
$statusCode = $response->getStatusCode();       // e.g. 200
$isOk = $response->ok();                       // true if 200
$isUnauthorized = $response->unauthorized();   // true if 401
$isForbidden = $response->forbidden();         // true if 403
$isNotFound = $response->notFound();           // true if 404
$isServerError = $response->serverError();     // true if 5xx
$isSuccessful = $response->successful();       // true if < 400 and no error

// Content access
$body = $response->body();                     // Raw body string
$data = $response->json();                     // Decoded JSON array
$value = $response->json('user.name');         // Access JSON via dot notation
$array = $response->toArray();                 // Response as array including timing metrics

// Headers
$contentType = $response->header('Content-Type');  // Get a single header
$allHeaders = $response->getHeaders();            // Get all headers
$hasHeader = $response->hasHeader('X-Custom');    // Check if header exists

// Performance
$duration = $response->getDuration();             // Response read duration in seconds
$connectTime = $response->getConnectDuration();   // TCP connect duration in milliseconds
$writeTime = $response->getWriteDuration();       // Request write duration in milliseconds
$attempts = $response->getAttempts();             // Number of retry attempts made

// Exception handling
$response->throw();                               // Throws if status >= 400
$response->throwIf($condition);                   // Conditional throw
$response->throwUnless($condition);               // Conditional throw
```

🔁 Concurrent Requests with Laravel's Concurrency Facade
-------------------------------------------------------

[](#-concurrent-requests-with-laravels-concurrency-facade)

For Laravel 11+, you can use Laravel's built-in Concurrency facade to execute multiple FastCGI requests in parallel:

```
use Illuminate\Support\Facades\Concurrency;

$responses = Concurrency::concurrent([
    'products' => fn() => FCGI::get('product-service.internal/api/products'),
    'categories' => fn() => FCGI::get('catalog-service.internal/api/categories'),
    'user' => fn() => FCGI::withToken($token)->get('user-service.internal/api/user'),
]);

// Access responses by key
$products = $responses['products']->json();
$categories = $responses['categories']->json();
$user = $responses['user']->json();
```

Moore Examples
--------------

[](#moore-examples)

### Accessing a Remote API with URL Templates

[](#accessing-a-remote-api-with-url-templates)

```
$response = FCGI::withToken($apiToken)
    ->acceptJson()
    ->withUrlParameters(['userId' => auth()->id()])
    ->timeout(5)
    ->scriptPath('/var/www/html/api/public/index.php')
    ->get('api-backend.internal/api/v1/users/{userId}/stats/daily');

return $response->json();
```

### Submitting a Form to a Remote Application

[](#submitting-a-form-to-a-remote-application)

```
$response = FCGI::asForm()
    ->scriptPath('/var/www/html/contact/public/index.php')
    ->post('contact-service.internal/submit-form', [
        'email' => $request->email,
        'name' => $request->name,
        'message' => $request->message,
    ]);

if ($response->successful()) {
    return redirect()->back()->with('success', 'Your message has been sent!');
} else {
    return redirect()->back()->with('error', 'Failed to send message.');
}
```

### Creating a Resource on a Remote Service

[](#creating-a-resource-on-a-remote-service)

```
$response = FCGI::withHeaders([
        'X-API-Key' => config('services.blog.api_key'),
    ])
    ->asJson()
    ->scriptPath('/var/www/html/blog/public/index.php')
    ->post('blog-service.internal/api/posts', [
        'title' => $request->title,
        'content' => $request->content,
        'author_id' => Auth::id(),
    ]);

return response()->json($response->json(), $response->getStatusCode());
```

### RESTful API with URL Templates

[](#restful-api-with-url-templates)

```
// GET /api/users/123/posts/456/comments
$response = FCGI::withUrlParameters([
        'userId' => $user->id,
        'postId' => $post->id
    ])
    ->scriptPath('/var/www/blog/public/index.php')
    ->get('blog-service.internal/api/users/{userId}/posts/{postId}/comments', ['include' => 'author,replies']);

// PUT /api/users/123/profile
$response = FCGI::withUrlParameters(['userId' => $user->id])
    ->asJson()
    ->scriptPath('/var/www/user/public/index.php')
    ->put('user-service.internal/api/users/{userId}/profile', [
        'name' => $request->name,
        'bio' => $request->bio
    ]);

// DELETE /api/posts/456
$response = FCGI::withUrlParameters(['postId' => $post->id])
    ->scriptPath('/var/www/blog/public/index.php')
    ->delete('blog-service.internal/api/posts/{postId}');
```

### Fetching Data from Multiple Services

[](#fetching-data-from-multiple-services)

```
use Illuminate\Support\Facades\Concurrency;

$user = auth()->user();

$dashboard = Concurrency::concurrent([
    'profile' => fn() => FCGI::scriptPath('/var/www/user-service/public/index.php')
        ->withUrlParameters(['userId' => $user->id])
        ->get('user-service.internal/api/users/{userId}'),

    'orders' => fn() => FCGI::withUrlParameters(['userId' => $user->id])
        ->withQuery(['status' => 'active'])
        ->scriptPath('/var/www/order-service/public/index.php')
        ->get('order-service.internal/api/users/{userId}/orders'),

    'notifications' => fn() => FCGI::withUrlParameters(['userId' => $user->id])
        ->scriptPath('/var/www/notification-service/public/index.php')
        ->port(12345)
        ->get('notification-service.internal/api/users/{userId}/notifications', ['unread' => true]),
]);

return view('dashboard', [
    'profile' => $dashboard['profile']->json(),
    'orders' => $dashboard['orders']->json(),
    'notificationCount' => count($dashboard['notifications']->json('data')),
]);
```

Smart Content Type Defaults
---------------------------

[](#smart-content-type-defaults)

The package intelligently chooses content types based on the HTTP method:

```
// POST requests default to form-encoded data
FCGI::post('service.com', ['key' => 'value']);
// Content-Type: application/x-www-form-urlencoded

// PUT/PATCH requests default to JSON
FCGI::put('service.com', ['key' => 'value']);
// Content-Type: application/json

// Override defaults with explicit configuration
FCGI::asJson()->post('service.com', ['key' => 'value']);
// Content-Type: application/json

FCGI::asForm()->put('service.com', ['key' => 'value']);
// Content-Type: application/x-www-form-urlencoded
```

Error Handling
--------------

[](#error-handling)

The package provides several ways to handle errors:

```
// Using try-catch blocks
try {
    $response = FCGI::get('service.internal');
    return $response->json();
} catch (\Rizwan\LaravelFcgiClient\Exceptions\ConnectionException $e) {
    // Handle connection errors (e.g., service unreachable)
    Log::error('FastCGI connection failed: ' . $e->getMessage());
    return response()->json(['error' => 'Service unavailable'], 503);
} catch (\Rizwan\LaravelFcgiClient\Exceptions\TimeoutException $e) {
    // Handle timeout errors
    Log::error('FastCGI request timed out: ' . $e->getMessage());
    return response()->json(['error' => 'Request timed out'], 504);
} catch (\Rizwan\LaravelFcgiClient\Exceptions\FastCGIException $e) {
    // Handle all other FastCGI-related errors
    Log::error('FastCGI error: ' . $e->getMessage());
    return response()->json(['error' => 'Internal server error'], 500);
}

// Using the throw method and Laravel's error handling
$posts = FCGI::get('blog-service.internal', '/var/www/blog/public/index.php')
    ->throw()  // This will throw an exception if the request fails
    ->json();

// Using conditional throws
$response = FCGI::get('service.internal');

$response->throwIf(
    $response->getStatusCode() === 429,
    fn() => new RateLimitException('Too many requests')
);

// Using throwUnless
$response->throwUnless(
    $response->getStatusCode() === 200,
    fn() => new ServiceException('Expected 200 OK response')
);
```

Retry Logic
-----------

[](#retry-logic)

For unstable services or network connections, you can add retry logic with intelligent defaults:

```
// Basic retry (3 attempts with 500ms delay)
$response = FCGI::retry(3, 500)
    ->get('flaky-service.internal');

// By default, retries happen on:
// - Connection failures and timeouts (always)
// - Server errors (5xx status codes)
// - NOT on client errors (4xx status codes)

// Custom retry logic based on the exception or response
$response = FCGI::retry(3, 1000, function ($exceptionOrResponse, $request) {
    // Only retry for connection and timeout issues
    if ($exceptionOrResponse instanceof \Throwable) {
        return $exceptionOrResponse instanceof ConnectionException ||
               $exceptionOrResponse instanceof TimeoutException;
    }

    // For responses, retry on server errors but not client errors
    if ($exceptionOrResponse instanceof Response) {
        return $exceptionOrResponse->serverError();
    }

    return false;
})
->withToken($token)
->get('api-service.internal');

// Check retry attempts
$response = FCGI::retry(3)->get('service.com');
echo "Request took {$response->getAttempts()} attempts";
```

🧪 Testing
---------

[](#-testing)

Tests are written using [Pest PHP](https://pestphp.com). Run them with:

```
./vendor/bin/pest
```

📜 License
---------

[](#-license)

The MIT License (MIT). Please see [License File](LICENSE) for more information.

###  Health Score

35

—

LowBetter than 80% of packages

Maintenance54

Moderate activity, may be stable

Popularity16

Limited adoption so far

Community7

Small or concentrated contributor base

Maturity51

Maturing project, gaining track record

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~21 days

Total

3

Last Release

317d ago

### Community

Maintainers

![](https://www.gravatar.com/avatar/2f850524484adbf2f9239b47f348f4dbf54aefdd951310ef5865510a0ac27fe9?d=identicon)[muhammad-rizwan](/maintainers/muhammad-rizwan)

---

Top Contributors

[![muhammad-rizwan](https://avatars.githubusercontent.com/u/486343?v=4)](https://github.com/muhammad-rizwan "muhammad-rizwan (7 commits)")

---

Tags

httpclientlaravellaravel-packagefastcgiphp-fpmfcgi

###  Code Quality

TestsPest

Code StyleLaravel Pint

### Embed Badge

![Health badge](/badges/mrizwan-laravel-fcgi-client/health.svg)

```
[![Health](https://phpackages.com/badges/mrizwan-laravel-fcgi-client/health.svg)](https://phpackages.com/packages/mrizwan-laravel-fcgi-client)
```

###  Alternatives

[pusher/pusher-http-laravel

\[DEPRECATED\] A Pusher bridge for Laravel

400509.0k3](/packages/pusher-pusher-http-laravel)[vinelab/http

An http library developed for the laravel framework. aliases itself as HttpClient

59300.2k11](/packages/vinelab-http)[laravel-shift/curl-converter

A command line tool to convert curl requests to Laravel HTTP requests.

935.3k](/packages/laravel-shift-curl-converter)[tomschlick/request-migrations

HTTP Request Migrations

1844.5k](/packages/tomschlick-request-migrations)[rap2hpoutre/jacky

Opinionated REST JSON HTTP API client for laravel

174.4k](/packages/rap2hpoutre-jacky)[dragon-code/laravel-http-logger

Logging incoming HTTP requests

319.8k3](/packages/dragon-code-laravel-http-logger)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
