PHPackages                             michtio/craftcms-claude-skills - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Templating &amp; Views](/categories/templating)
4. /
5. michtio/craftcms-claude-skills

ActiveLibrary[Templating &amp; Views](/categories/templating)

michtio/craftcms-claude-skills
==============================

Craft CMS 5 expertise as Claude Code skills + a thin PHP API. Consumed by Claude Code (skills plugin) and craftpulse/craft-cortex (MCP prompts/resources).

v1.7.2(3w ago)5918↓66.7%4[1 issues](https://github.com/michtio/craftcms-claude-skills/issues)[1 PRs](https://github.com/michtio/craftcms-claude-skills/pulls)MITShellPHP ^8.2

Since May 6Pushed 1mo ago1 watchersCompare

[ Source](https://github.com/michtio/craftcms-claude-skills)[ Packagist](https://packagist.org/packages/michtio/craftcms-claude-skills)[ Docs](https://github.com/michtio/craftcms-claude-skills)[ Fund](https://www.buymeacoffee.com/michtio)[ GitHub Sponsors](https://github.com/michtio)[ RSS](/packages/michtio-craftcms-claude-skills/feed)WikiDiscussions main Synced 3w ago

READMEChangelog (10)DependenciesVersions (29)Used By (0)

Craft CMS Claude Skills
=======================

[](#craft-cms-claude-skills)

> Production-ready [Claude Code](https://docs.anthropic.com/en/docs/claude-code) skills, agents, and project templates for Craft CMS 5 development.

Built and maintained by [michtio](https://github.com/michtio). Covers both **plugin/module development** (extending Craft) and **site development** (content modeling, Twig templates, front-end architecture).

Support
-------

[](#support)

If this project saves you time, consider supporting its development:

- [GitHub Sponsors](https://github.com/sponsors/michtio)
- [Buy Me a Coffee](https://buymeacoffee.com/michtio)

Quick Start
-----------

[](#quick-start)

### 1. Install

[](#1-install)

```
# Claude Code Plugin (recommended)
# First time: add the marketplace, then install
/plugin marketplace add michtio/craftcms-claude-skills
/plugin install craftcms-claude-skills@michtio/craftcms-claude-skills

# Or via Vercel Skills CLI
npx skills add michtio/craftcms-claude-skills --all

# Or clone manually
git clone https://github.com/michtio/craftcms-claude-skills.git ~/.claude/craftcms-claude-skills
cd ~/.claude/craftcms-claude-skills && bash install.sh
```

### 2. Set Up Your Project

[](#2-set-up-your-project)

Open Claude Code in your Craft project and say:

```
Set up Claude for this Craft project

```

The `craft-project-setup` skill detects your project type (plugin, site, module, hybrid, or monorepo) and generates a tailored `CLAUDE.md` and `.claude/rules/` directory.

### 3. Start Building

[](#3-start-building)

The skills trigger automatically based on what you're doing. Just describe what you need:

```
Build a blog with topics, authors, and a flexible body builder using CKEditor

```

Claude loads the right skills, follows Craft conventions, and uses the correct field handles, DDEV commands, and project config workflow.

Example Prompts
---------------

[](#example-prompts)

Just describe what you need — skills trigger automatically and produce high-quality results. A few to show the range, grouped by domain:

**Content modeling &amp; architecture**

```
Plan the content architecture for a multi-language corporate site with
news, team members, office locations, and a service catalog. We need
English, German, and French with subfolder-per-language routing.

```

**Plugins &amp; modules**

```
Build a custom element type for "Job Listings" with postDate/expiryDate
status, a categories relation for departments, and a CP edit page with
field layout designer.

```

**Control panel &amp; author experience**

```
I need a modal dialog for my Craft plugin that opens when clicking
"Add Item", shows a form with name and handle fields, POSTs to my
plugin's save action, and closes on success. Make it keyboard accessible.

```

**Front-end &amp; Twig**

```
Create an atomic button component that supports links, form submits,
and disabled states. It needs size variants and a loading spinner option.

```

```
Build a member area with registration, login, password reset, and
profile editing. Users should be in the "Members" group and only see
content in the gated section.

```

**Hosting &amp; deployment**

```
Set this project up to deploy on Servd: Servd asset storage, static
caching with Blitz in reverse-proxy mode, and the dedicated queue
runner. Document the constraints in CLAUDE.md.

```

```
Configure Redis for cache, sessions, and mutex in our Craft project.
We're running DDEV locally and deploying to a VPS with Redis installed.

```

See [docs/prompt-guide.md](docs/prompt-guide.md) for 40+ prompts organized by task type — content modeling, plugin development, field types, security, Twig, CP/JS, configuration &amp; deployment, testing, and headless.

What's Inside
-------------

[](#whats-inside)

### Skills

[](#skills)

SkillTrackKey Coverage`craftcms`PluginElements, queries, services, controllers, migrations, events, GraphQL, configuration, caching, permissions, CP templates (form macros, settings, navigation), CP components (widgets, utilities, slideouts), CP UI patterns (tri-state, condition builders, asset bundles), console commands (80+ commands), debugging. 30 reference files.`craft-php-guidelines`PluginPHPDocs, section headers, naming, class organization, ECS/PHPStan. 5 reference files.`craft-content-modeling`SiteSections, entry types, fields, Matrix, relations, eager loading, entrification. Reuse-first field workflow. 6 reference files.`craft-site`SiteAtomic design, component patterns, routing, Vite, auth flows, search, feeds, headless. 18 reference files.`craft-plugins`Plugin ReferencesName-routed index of third-party plugin guidance (config, Twig/PHP API, migrations, deployment, pitfalls), discoverable from any task altitude. 23 plugin references.`craft-twig-guidelines`SiteVariable naming, null handling, whitespace, include isolation, Craft helpers, `collect()`.`craft-garnish`PluginGarnish CP JavaScript: class system, UI widgets, drag system, ARIA/focus, Craft.\* pattern. 5 reference files.`ddev`SharedCommands, services, configuration, Xdebug, site sharing, troubleshooting.`craft-project-setup`SharedProject scaffolding, upgrade, and audit. Generates CLAUDE.md, .claude/rules/, .claude/settings.local.json (permissions). Gap analysis for existing configs.`craft-cloud`SharedCraft Cloud serverless hosting: `craft-cloud.yaml`, Build → Migrate → Release pipeline, the `craftcms/cloud` extension, edge image transforms, static caching + ESI, MySQL 8 / Postgres 15 constraints, Console command runner, plugin Cloud-compatibility, self-hosted → Cloud migration. 12 reference files.`servd`SharedServd managed hosting: git push-to-deploy + `servd.yaml`, local → staging → production sync, the `servd/craft-asset-storage` plugin (svdcdn CDN, off-server transforms), Servd static caching + Blitz reverse-proxy mode, MariaDB/MySQL over SSH, backups, Dedicated Queue Runner, ephemeral filesystem. 6 reference files.11 skills, 105 reference files. Skills load automatically and declare companion skills so related knowledge loads together. See [docs/skills-overview.md](docs/skills-overview.md) for the full breakdown.

### Agents

[](#agents)

AgentModelPurpose`craft-planner`OpusDecompose features into vertical slices with verification gates. Can research/audit public plugins via `gh` and `git clone`.`craft-feature-builder`OpusBuild plugin code feature by feature with automated + manual test gates`craft-site-builder`OpusSite templates and components feature by feature with build-verify gates`craft-debugger`SonnetSystematic bug investigation`craft-code-reviewer`SonnetFull-stack review against a structured checklist: PHP, Twig, JS, CSS, config`craft-code-reviewer-deep`OpusDeep review for high-stakes PRs (release branches, security, migrations, multi-service flows): cross-file data flow, untested paths, race conditions, scale concernsAgents build feature by feature (vertical slices), not layer by layer. Tests are written alongside each layer, not batched at the end. Manual testing gates (required + optional) are identified per feature. The builder's prevention rules map directly to the reviewer's checklist across PHP, Twig, JS, and CSS; `craft-code-reviewer-deep` (Opus) goes further for high-stakes changes. See [docs/agents.md](docs/agents.md) for details.

### Plugin Reference Library

[](#plugin-reference-library)

23 Craft plugins with detailed configuration, Twig/PHP API, and common pitfalls — indexed and name-routed by the `craft-plugins` skill, so they surface from front-end, PHP, migration, and deployment tasks alike:

View all 23 plugin referencesPluginAuthorKey SurfaceSEOmaticnystudio107Meta cascade, JSON-LD, sitemaps, GraphQLBlitzputyourlightsonStatic caching, Cloudflare, dynamic content, purgersFormieverbbForm rendering, Tailwind theming, submissions, hooksImageOptimizenystudio107Responsive images, transforms, loading strategiesCKEditorcraftcmsRich text, nested entries, HTML PurifierSprigputyourlightsonReactive Twig components (htmx)Element APIcraftcmsJSON API endpointsRetournystudio107Redirects, 404 trackingNavigationverbbMenu node querying, active statesHyperverbbLink fields, button integrationColour SwatchescraftpulseColor palettes, Tailwind class mappingPassword PolicycraftpulseValidation rules, HIBP checkTypogrifynystudio107Typography filters, widow preventionCache IgniterputyourlightsonCDN cache warmingKnock KnockverbbStaging password protectionElements PanelputyourlightsonDebug toolbar, N+1 detectionSherlockputyourlightsonSecurity scanningEmbedded AssetsspicyweboEmbed as assetsAmazon SESputyourlightsonSES mail transportTimeloopcraftpulseRecurring datesFeed MecraftcmsData import from XML/JSON/CSV, CLI automationImager-XspacecatninjaAdvanced image transforms, named presets, effectsVitenystudio107Asset loading (`craft.vite.*`), critical CSS, dev server, manifestDocumentation
-------------

[](#documentation)

GuideWhat it covers[Getting Started](docs/getting-started.md)Installation, project setup, how skills auto-trigger, first steps[Skills Overview](docs/skills-overview.md)All 11 skills with triggers, companion skills, reference counts, boundaries[Prompt Guide](docs/prompt-guide.md)40+ real-world prompts organized by task type[Agents](docs/agents.md)6 agents with tools, gate patterns, composition examples[Contributing](docs/contributing.md)Adding plugin references, improving skills, reporting issuesRequirements
------------

[](#requirements)

- [Claude Code](https://docs.anthropic.com/en/docs/claude-code) installed and configured
- [DDEV](https://ddev.com) for local Craft CMS development
- Craft CMS 5.x
- Bash (macOS/Linux) for the install script

Versioning
----------

[](#versioning)

This package follows its own [semantic versioning](https://semver.org), driven by the pack's own content — it is **not** pinned to Craft's minor releases:

- **Patch** (e.g. 1.6.0 → 1.6.1) — accuracy fixes, corrections, small content updates
- **Minor** (e.g. 1.5.x → 1.6.0) — new skills, new plugin references, significant content additions
- **Major** (1.x → 2.x) — Craft's next major (5.x → 6.x, where APIs break) or a major reorganization of the pack

The pack targets **Craft CMS 5, latest minor** (currently 5.10). Behaviour specific to a Craft minor is annotated inline in the content (e.g. "since 5.10.0"), so a single line serves projects on any Craft 5 minor — the minors are additive and backward-compatible. New content like a hosting skill or plugin reference is a feature of the pack, independent of which Craft minor is current.

Development happens on `main`. The `1.4.x` branch is a **frozen snapshot targeting Craft 5.9** — it received a final quality release and no longer takes new work; all new development lands on `main`. The `release-validation` workflow enforces that manifest versions match the release tag.

Roadmap
-------

[](#roadmap)

- Upgrade guide (Craft 3→4, 4→5, 3→5) with deprecated plugin mapping and migration paths
- DDEV skill expansion (Xdebug deep-dive, custom services, production parity)
- Commerce skill (products, variants, orders, carts, payments -- separate skill)
- CKEditor 4→5 migration guide (config conversion, custom styles, plugin mapping, HTML cleanup)
- More plugin references (Neo, Scout, Campaign)

Contributing
------------

[](#contributing)

Contributions welcome. See [docs/contributing.md](docs/contributing.md) for how to add plugin references, improve skills, and report issues.

For PHP consumers (composer)
----------------------------

[](#for-php-consumers-composer)

The same repo also ships as a small composer package, exposing the bundled skills' markdown to PHP code through a thin static helper. The primary consumer is [`craftpulse/craft-cortex`](https://github.com/craftpulse/craft-cortex) — a Craft CMS 5 MCP server plugin that surfaces these skills as MCP prompts and resources to AI agents.

```
composer require michtio/craftcms-claude-skills
```

```
use Michtio\CraftCmsClaudeSkills\Skills;

Skills::skillNames();
// ['craft-content-modeling', 'craft-garnish', 'craft-php-guidelines', ...]

Skills::content('craftcms');
// Full SKILL.md content as a string

Skills::references('craftcms');
// ['architecture', 'caching', 'conditions', ...]

Skills::referenceContent('craftcms', 'elements');
// Full reference markdown as a string

Skills::agentNames();
// ['craft-code-reviewer', 'craft-debugger', 'craft-feature-builder', ...]

Skills::agentContent('craft-debugger');
// Full agent markdown (frontmatter + body) as a string
```

The helper is read-only and does no caching — wrap it in your own registry if you need that. PHP 8.2+.

License
-------

[](#license)

MIT -- see [LICENSE](LICENSE).

###  Health Score

48

—

FairBetter than 94% of packages

Maintenance92

Actively maintained with recent releases

Popularity21

Limited adoption so far

Community9

Small or concentrated contributor base

Maturity57

Maturing project, gaining track record

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~2 days

Total

27

Last Release

23d ago

### Community

Maintainers

![](https://www.gravatar.com/avatar/c7d5b4ecc0f3577f5a56f8411148e5d35d76e31593ff8529146acae89c5ad321?d=identicon)[michtio](/maintainers/michtio)

---

Top Contributors

[![turnavies](https://avatars.githubusercontent.com/u/5601713?v=4)](https://github.com/turnavies "turnavies (2 commits)")

---

Tags

agent-skillsclaude-codeclaude-code-pluginclaude-code-skillsclaude-skillscontent-modelingcraft-cmscraft-cms-5craftcmsddevphptwigphptwigmcpcraftcmsskillsclaudecraft cms

### Embed Badge

![Health badge](/badges/michtio-craftcms-claude-skills/health.svg)

```
[![Health](https://phpackages.com/badges/michtio-craftcms-claude-skills/health.svg)](https://phpackages.com/packages/michtio-craftcms-claude-skills)
```

###  Alternatives

[nystudio107/craft-autocomplete

Provides Twig template IDE autocomplete of Craft CMS &amp; plugin variables

43225.6k18](/packages/nystudio107-craft-autocomplete)[wbrowar/guide

A CMS Guide for Craft CMS.

6154.7k1](/packages/wbrowar-guide)[nystudio107/craft-emptycoalesce

Empty Coalesce adds the ??? operator to Twig that will return the first thing that is defined, not null, and not empty.

27146.3k3](/packages/nystudio107-craft-emptycoalesce)[jalendport/craft-preparse

A fieldtype that parses Twig when an element is saved and saves the result as plain text.

1078.1k](/packages/jalendport-craft-preparse)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
