PHPackages mediawiki/mermaid - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Utility & Helpers](/categories/utility) 4. / 5. mediawiki/mermaid ActiveMediawiki-extension[Utility & Helpers](/categories/utility) mediawiki/mermaid ================= Provides a parser function to generate diagrams and charts with the help of the mermaid script language 6.0.2(7mo ago)4665.4k↑30.5%26[21 issues](https://github.com/SemanticMediaWiki/Mermaid/issues)[2 PRs](https://github.com/SemanticMediaWiki/Mermaid/pulls)1GPL-2.0-or-laterPHPPHP >=7.4CI passing Since Jan 16Pushed 4d ago16 watchersCompare [ Source](https://github.com/SemanticMediaWiki/Mermaid)[ Packagist](https://packagist.org/packages/mediawiki/mermaid)[ Docs](https://github.com/SemanticMediaWiki/Mermaid)[ Fund](https://www.semantic-mediawiki.org/wiki/Sponsorship)[ Fund](https://opencollective.com/smw)[ RSS](/packages/mediawiki-mermaid/feed)WikiDiscussions master Synced 1w ago READMEChangelog (10)Dependencies (6)Versions (21)Used By (1) Mermaid ======= [](#mermaid) [![CI](https://github.com/SemanticMediaWiki/Mermaid/actions/workflows/ci.yml/badge.svg)](https://github.com/SemanticMediaWiki/Mermaid/actions/workflows/ci.yml)[![codecov](https://camo.githubusercontent.com/83174603a9e9a600c47411e723132412f07fbf4b577a0beb46d7f054354bfa44/68747470733a2f2f636f6465636f762e696f2f67682f53656d616e7469634d6564696157696b692f4d65726d6169642f6272616e63682f6d61737465722f67726170682f62616467652e7376673f746f6b656e3d363543366653556d754f)](https://codecov.io/gh/SemanticMediaWiki/Mermaid)[![Latest Stable Version](https://camo.githubusercontent.com/065f49c7faac76769a9b8bc9789978064fbff6e3c52214c4c8778fbe3b53c739/68747470733a2f2f706f7365722e707567782e6f72672f6d6564696177696b692f6d65726d6169642f76657273696f6e2e706e67)](https://packagist.org/packages/mediawiki/mermaid)[![Packagist download count](https://camo.githubusercontent.com/5bee3bd580f8cb7b4f104135037ac571c311dda9240cec1b316b1ba56b6cbe48/68747470733a2f2f706f7365722e707567782e6f72672f6d6564696177696b692f6d65726d6169642f642f746f74616c2e706e67)](https://packagist.org/packages/mediawiki/mermaid) This extension provides the `#mermaid` parser function to support the generation of diagrams and flowcharts with the help of the [mermaid](https://github.com/knsv/mermaid) script language. Supported diagram forms include: - Flowchart - Sequence Diagram - Class Diagram - State Diagram - Gantt Chart - Pie Chart - Entity Relationship Diagram - Git Flow Chart - User Journey Chart - Quadrant Chart - Requirement Diagram - C4 Diagram - Timeline Diagram - Sankey Diagram - XY Chart - Block Diagram Requirements ------------ [](#requirements) Requirements for Mermaid 6.x: - PHP 8.1 or later - MediaWiki 1.43 or later You can use an older version of Mermaid for older versions of MediaWiki and/or PHP. Installation and configuration ------------------------------ [](#installation-and-configuration) See the information on [installing and configuring](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/INSTALL.md) this extension. Usage ----- [](#usage) See the information on [using](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/USAGE.md) this extension. Contribution and support ------------------------ [](#contribution-and-support) If you want to contribute work to the project please subscribe to the developers mailing list and have a look at the contribution guideline. - [File an issue](https://github.com/SemanticMediaWiki/Mermaid/issues) - [Submit a pull request](https://github.com/SemanticMediaWiki/Mermaid/pulls) - Ask a question on [the mailing list](https://www.semantic-mediawiki.org/wiki/Mailing_list) For developers -------------- [](#for-developers) See the documention on how to [update MermaidJS](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/UPDATEMERMAID.md). Tests ----- [](#tests) This extension provides unit and integration tests that are run by a [continues integration platform](https://travis-ci.org/SemanticMediaWiki/Mermaid)but can also be executed using `composer phpunit` from the extension base directory. License ------- [](#license) [GNU General Public License, version 2 or later](https://www.gnu.org/copyleft/gpl.html). ### Health Score 59 — FairBetter than 98% of packages Maintenance75 Regular maintenance activity Popularity45 Moderate usage in the ecosystem Community31 Small or concentrated contributor base Maturity72 Established project with proven stability Bus Factor4 4 contributors hold 50%+ of commits How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** — Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~178 days Recently: every ~30 days Total 17 Last Release 221d ago Major Versions 1.0.1 → 2.0.02019-02-18 2.2.0 → 3.0.02020-08-10 3.1.0 → 4.0.02025-07-02 4.0.1 → 5.0.02025-07-02 5.0.2 → 6.0.02025-07-07 PHP version history (3 changes)1.0.0PHP >=5.6.0 3.0.0PHP >=7.0.0 4.0.0PHP >=7.4 ### Community Maintainers ![](https://avatars.githubusercontent.com/u/22235?v=4)[Stefan Wasilewski](/maintainers/SMW)[@smw](https://github.com/smw) ![](https://www.gravatar.com/avatar/372f9bc1233d5518b9522cb681210a8de2765a3a9bbde20138f6ad5332a411ca?d=identicon)[mwjames](/maintainers/mwjames) ![](https://avatars.githubusercontent.com/u/1104078?v=4)[Karsten Hoffmeyer](/maintainers/kghbln)[@kghbln](https://github.com/kghbln) --- Top Contributors [![kghbln](https://avatars.githubusercontent.com/u/1104078?v=4)](https://github.com/kghbln "kghbln (31 commits)")[![translatewiki](https://avatars.githubusercontent.com/u/24829418?v=4)](https://github.com/translatewiki "translatewiki (28 commits)")[![gesinn-it-gea](https://avatars.githubusercontent.com/u/10398316?v=4)](https://github.com/gesinn-it-gea "gesinn-it-gea (21 commits)")[![gesinn-it-ilm](https://avatars.githubusercontent.com/u/169881483?v=4)](https://github.com/gesinn-it-ilm "gesinn-it-ilm (19 commits)")[![JeroenDeDauw](https://avatars.githubusercontent.com/u/146040?v=4)](https://github.com/JeroenDeDauw "JeroenDeDauw (18 commits)")[![paladox](https://avatars.githubusercontent.com/u/5727000?v=4)](https://github.com/paladox "paladox (14 commits)")[![gesinn-it-evl](https://avatars.githubusercontent.com/u/137869039?v=4)](https://github.com/gesinn-it-evl "gesinn-it-evl (13 commits)")[![howlowck](https://avatars.githubusercontent.com/u/338265?v=4)](https://github.com/howlowck "howlowck (13 commits)")[![dependabot[bot]](https://avatars.githubusercontent.com/in/29110?v=4)](https://github.com/dependabot[bot] "dependabot[bot] (12 commits)")[![mwjames](https://avatars.githubusercontent.com/u/1245473?v=4)](https://github.com/mwjames "mwjames (8 commits)")[![krabina](https://avatars.githubusercontent.com/u/4318745?v=4)](https://github.com/krabina "krabina (2 commits)")[![NikitaRana07](https://avatars.githubusercontent.com/u/35731076?v=4)](https://github.com/NikitaRana07 "NikitaRana07 (2 commits)")[![marko220991](https://avatars.githubusercontent.com/u/92681403?v=4)](https://github.com/marko220991 "marko220991 (1 commits)")[![cscott](https://avatars.githubusercontent.com/u/156080?v=4)](https://github.com/cscott "cscott (1 commits)")[![cicalese](https://avatars.githubusercontent.com/u/1015024?v=4)](https://github.com/cicalese "cicalese (1 commits)")[![felickz](https://avatars.githubusercontent.com/u/1760475?v=4)](https://github.com/felickz "felickz (1 commits)")[![SomeMWDev](https://avatars.githubusercontent.com/u/186634068?v=4)](https://github.com/SomeMWDev "SomeMWDev (1 commits)")[![LordAro](https://avatars.githubusercontent.com/u/4007992?v=4)](https://github.com/LordAro "LordAro (1 commits)") --- Tags chartchartsdiagramdiagramsflow-chartflowchartgantt-chartganttchartgraphsmediawikimermaidsequence-diagrammediawikimermaidparser function ### Embed Badge ![Health badge](/badges/mediawiki-mermaid/health.svg) ``` [![Health](https://phpackages.com/badges/mediawiki-mermaid/health.svg)](https://phpackages.com/packages/mediawiki-mermaid) ``` ### Alternatives [helsingborg-stad/municipio A bootstrap theme for creating municipality sites. 4028.3k10](/packages/helsingborg-stad-municipio)[mediawiki/maps Adds various mapping features to MediaWiki 79149.7k3](/packages/mediawiki-maps)[starcitizentools/citizen-skin A beautiful, usable, responsive MediaWiki skin with in-depth extension support. Originally developed for the Star Citizen Wiki. 3335.8k](/packages/starcitizentools-citizen-skin)[mediawiki/page-forms Forms for creating and editing wiki pages. 2179.3k2](/packages/mediawiki-page-forms)[professional-wiki/network MediaWiki extension for adding interactive network visualizations to your wiki pages 3213.0k](/packages/professional-wiki-network)[civicrm/civicrm-drupal-8 Open source constituent relationship management for non-profits, NGOs and advocacy organizations. 19246.3k2](/packages/civicrm-civicrm-drupal-8) PHPackages © 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)