PHPackages                             mediawiki/mermaid - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Utility &amp; Helpers](/categories/utility)
4. /
5. mediawiki/mermaid

ActiveMediawiki-extension[Utility &amp; Helpers](/categories/utility)

mediawiki/mermaid
=================

Provides a parser function to generate diagrams and charts with the help of the mermaid script language

6.0.2(8mo ago)4667.7k↑45.8%26[21 issues](https://github.com/SemanticMediaWiki/Mermaid/issues)[2 PRs](https://github.com/SemanticMediaWiki/Mermaid/pulls)1GPL-2.0-or-laterPHPPHP &gt;=7.4CI passing

Since Jan 16Pushed 1mo ago16 watchersCompare

[ Source](https://github.com/SemanticMediaWiki/Mermaid)[ Packagist](https://packagist.org/packages/mediawiki/mermaid)[ Docs](https://github.com/SemanticMediaWiki/Mermaid)[ Fund](https://www.semantic-mediawiki.org/wiki/Sponsorship)[ Fund](https://opencollective.com/smw)[ RSS](/packages/mediawiki-mermaid/feed)WikiDiscussions master Synced 3w ago

READMEChangelog (10)Dependencies (6)Versions (21)Used By (1)

Mermaid
=======

[](#mermaid)

[![CI](https://github.com/SemanticMediaWiki/Mermaid/actions/workflows/ci.yml/badge.svg)](https://github.com/SemanticMediaWiki/Mermaid/actions/workflows/ci.yml)[![codecov](https://camo.githubusercontent.com/83174603a9e9a600c47411e723132412f07fbf4b577a0beb46d7f054354bfa44/68747470733a2f2f636f6465636f762e696f2f67682f53656d616e7469634d6564696157696b692f4d65726d6169642f6272616e63682f6d61737465722f67726170682f62616467652e7376673f746f6b656e3d363543366653556d754f)](https://codecov.io/gh/SemanticMediaWiki/Mermaid)[![Latest Stable Version](https://camo.githubusercontent.com/065f49c7faac76769a9b8bc9789978064fbff6e3c52214c4c8778fbe3b53c739/68747470733a2f2f706f7365722e707567782e6f72672f6d6564696177696b692f6d65726d6169642f76657273696f6e2e706e67)](https://packagist.org/packages/mediawiki/mermaid)[![Packagist download count](https://camo.githubusercontent.com/5bee3bd580f8cb7b4f104135037ac571c311dda9240cec1b316b1ba56b6cbe48/68747470733a2f2f706f7365722e707567782e6f72672f6d6564696177696b692f6d65726d6169642f642f746f74616c2e706e67)](https://packagist.org/packages/mediawiki/mermaid)

This extension provides the `#mermaid` parser function to support the generation of diagrams and flowcharts with the help of the [mermaid](https://github.com/knsv/mermaid) script language. Supported diagram forms include:

- Flowchart
- Sequence Diagram
- Class Diagram
- State Diagram
- Gantt Chart
- Pie Chart
- Entity Relationship Diagram
- Git Flow Chart
- User Journey Chart
- Quadrant Chart
- Requirement Diagram
- C4 Diagram
- Timeline Diagram
- Sankey Diagram
- XY Chart
- Block Diagram

Requirements
------------

[](#requirements)

Requirements for Mermaid 6.x:

- PHP 8.1 or later
- MediaWiki 1.43 or later

You can use an older version of Mermaid for older versions of MediaWiki and/or PHP.

Installation and configuration
------------------------------

[](#installation-and-configuration)

See the information on [installing and configuring](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/INSTALL.md) this extension.

Usage
-----

[](#usage)

See the information on [using](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/USAGE.md) this extension.

Contribution and support
------------------------

[](#contribution-and-support)

If you want to contribute work to the project please subscribe to the developers mailing list and have a look at the contribution guideline.

- [File an issue](https://github.com/SemanticMediaWiki/Mermaid/issues)
- [Submit a pull request](https://github.com/SemanticMediaWiki/Mermaid/pulls)
- Ask a question on [the mailing list](https://www.semantic-mediawiki.org/wiki/Mailing_list)

For developers
--------------

[](#for-developers)

See the documention on how to [update MermaidJS](https://github.com/SemanticMediaWiki/Mermaid/blob/master/docs/UPDATEMERMAID.md).

Tests
-----

[](#tests)

This extension provides unit and integration tests that are run by a [continues integration platform](https://travis-ci.org/SemanticMediaWiki/Mermaid)but can also be executed using `composer phpunit` from the extension base directory.

License
-------

[](#license)

[GNU General Public License, version 2 or later](https://www.gnu.org/copyleft/gpl.html).

###  Health Score

57

—

FairBetter than 98% of packages

Maintenance67

Regular maintenance activity

Popularity45

Moderate usage in the ecosystem

Community31

Small or concentrated contributor base

Maturity72

Established project with proven stability

 Bus Factor4

4 contributors hold 50%+ of commits

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~178 days

Recently: every ~30 days

Total

17

Last Release

266d ago

Major Versions

1.0.1 → 2.0.02019-02-18

2.2.0 → 3.0.02020-08-10

3.1.0 → 4.0.02025-07-02

4.0.1 → 5.0.02025-07-02

5.0.2 → 6.0.02025-07-07

PHP version history (3 changes)1.0.0PHP &gt;=5.6.0

3.0.0PHP &gt;=7.0.0

4.0.0PHP &gt;=7.4

### Community

Maintainers

![](https://avatars.githubusercontent.com/u/22235?v=4)[Stefan Wasilewski](/maintainers/SMW)[@smw](https://github.com/smw)

![](https://www.gravatar.com/avatar/372f9bc1233d5518b9522cb681210a8de2765a3a9bbde20138f6ad5332a411ca?d=identicon)[mwjames](/maintainers/mwjames)

![](https://avatars.githubusercontent.com/u/1104078?v=4)[Karsten Hoffmeyer](/maintainers/kghbln)[@kghbln](https://github.com/kghbln)

---

Top Contributors

[![kghbln](https://avatars.githubusercontent.com/u/1104078?v=4)](https://github.com/kghbln "kghbln (31 commits)")[![translatewiki](https://avatars.githubusercontent.com/u/24829418?v=4)](https://github.com/translatewiki "translatewiki (28 commits)")[![gesinn-it-gea](https://avatars.githubusercontent.com/u/10398316?v=4)](https://github.com/gesinn-it-gea "gesinn-it-gea (21 commits)")[![gesinn-it-ilm](https://avatars.githubusercontent.com/u/169881483?v=4)](https://github.com/gesinn-it-ilm "gesinn-it-ilm (19 commits)")[![JeroenDeDauw](https://avatars.githubusercontent.com/u/146040?v=4)](https://github.com/JeroenDeDauw "JeroenDeDauw (18 commits)")[![paladox](https://avatars.githubusercontent.com/u/5727000?v=4)](https://github.com/paladox "paladox (14 commits)")[![gesinn-it-evl](https://avatars.githubusercontent.com/u/137869039?v=4)](https://github.com/gesinn-it-evl "gesinn-it-evl (13 commits)")[![howlowck](https://avatars.githubusercontent.com/u/338265?v=4)](https://github.com/howlowck "howlowck (13 commits)")[![dependabot[bot]](https://avatars.githubusercontent.com/in/29110?v=4)](https://github.com/dependabot[bot] "dependabot[bot] (12 commits)")[![mwjames](https://avatars.githubusercontent.com/u/1245473?v=4)](https://github.com/mwjames "mwjames (8 commits)")[![krabina](https://avatars.githubusercontent.com/u/4318745?v=4)](https://github.com/krabina "krabina (2 commits)")[![NikitaRana07](https://avatars.githubusercontent.com/u/35731076?v=4)](https://github.com/NikitaRana07 "NikitaRana07 (2 commits)")[![marko220991](https://avatars.githubusercontent.com/u/92681403?v=4)](https://github.com/marko220991 "marko220991 (1 commits)")[![cscott](https://avatars.githubusercontent.com/u/156080?v=4)](https://github.com/cscott "cscott (1 commits)")[![cicalese](https://avatars.githubusercontent.com/u/1015024?v=4)](https://github.com/cicalese "cicalese (1 commits)")[![felickz](https://avatars.githubusercontent.com/u/1760475?v=4)](https://github.com/felickz "felickz (1 commits)")[![SomeMWDev](https://avatars.githubusercontent.com/u/186634068?v=4)](https://github.com/SomeMWDev "SomeMWDev (1 commits)")[![LordAro](https://avatars.githubusercontent.com/u/4007992?v=4)](https://github.com/LordAro "LordAro (1 commits)")

---

Tags

chartchartsdiagramdiagramsflow-chartflowchartgantt-chartganttchartgraphsmediawikimermaidsequence-diagrammediawikimermaidparser function

### Embed Badge

![Health badge](/badges/mediawiki-mermaid/health.svg)

```
[![Health](https://phpackages.com/badges/mediawiki-mermaid/health.svg)](https://phpackages.com/packages/mediawiki-mermaid)
```

###  Alternatives

[helsingborg-stad/municipio

A bootstrap theme for creating municipality sites.

4028.5k10](/packages/helsingborg-stad-municipio)[mediawiki/maps

Adds various mapping features to MediaWiki

84152.3k3](/packages/mediawiki-maps)[starcitizentools/citizen-skin

A beautiful, usable, responsive MediaWiki skin with in-depth extension support. Originally developed for the Star Citizen Wiki.

3376.6k](/packages/starcitizentools-citizen-skin)[mediawiki/chameleon-skin

A highly flexible MediaWiki skin using Bootstrap 5

12585.7k2](/packages/mediawiki-chameleon-skin)[civicrm/civicrm-drupal-8

Open source constituent relationship management for non-profits, NGOs and advocacy organizations.

19251.4k3](/packages/civicrm-civicrm-drupal-8)[altis/core

Core module for Altis

19228.0k4](/packages/altis-core)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
