PHPackages                             kevinsmith/laravel-samesite-none-compat - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Utility &amp; Helpers](/categories/utility)
4. /
5. kevinsmith/laravel-samesite-none-compat

ActiveLibrary[Utility &amp; Helpers](/categories/utility)

kevinsmith/laravel-samesite-none-compat
=======================================

Provides support for legacy clients when using SameSite=None cookies in Laravel 5.8+

v1.0.0(6y ago)36353Apache-2.0PHPPHP &gt;=7.2

Since Feb 19Pushed 6y ago1 watchersCompare

[ Source](https://github.com/kevinsmith/laravel-samesite-none-compat)[ Packagist](https://packagist.org/packages/kevinsmith/laravel-samesite-none-compat)[ RSS](/packages/kevinsmith-laravel-samesite-none-compat/feed)WikiDiscussions master Synced 5d ago

READMEChangelog (2)Dependencies (5)Versions (3)Used By (0)

SameSite=None Compatibility Middleware for Laravel
==================================================

[](#samesitenone-compatibility-middleware-for-laravel)

Provides support for legacy clients when using cookies marked as `SameSite=None; Secure` in Laravel 5.8+

This package implements the first recommendation for handling incompatible clients outlined in [this fantastic web.dev article](https://web.dev/samesite-cookie-recipes/#handling-incompatible-clients) by [Rowan Merewood](https://github.com/rowan-m). If you're not sure why any of this matters or what is currently changing about the way browsers handle cookies' `SameSite` attribute, let me encourage you to read Rowan's thorough [SameSite explainer](https://web.dev/samesite-cookies-explained/).

How It Works
------------

[](#how-it-works)

In the past, a cookie without an explicit `SameSite` value could be written and read in a third-party context (e.g. your app in an iframe on another domain's page) without any restrictions from the browser. For security reasons, the most popular browsers (Chrome, Firefox, Safari, Edge) are now constraining their default cookie behavior so that cookies may only be read in a third-party context if they are marked as `SameSite=None; Secure`.

Ok, so we just need to update how we set those cookies, right? Not so fast. Unfortunately, marking cookies this way can make them [incompatible with older browsers](https://www.chromium.org/updates/same-site/incompatible-clients). And depending on your audience, *a lot* of people are still using older browsers.

This package employs a workaround to allow you to upgrade your app's cookies to meet current recommendations and still maintain compatibility with legacy browsers by including a fallback for all outgoing cookies marked `SameSite=None; Secure`. So if your app sets a cookie that looks like this:

```
appcookie=value; SameSite=None; Secure

```

This package will add a this fallback cookie in the response that gets sent back to the browser:

```
appcookie__ssn-fallback=value; Secure

```

When your app receives an incoming request, this package will inspect the cookies and promote any fallback cookies that don't already have a primary counterpart marked as `SameSite=None; Secure`.

Install
-------

[](#install)

Add the middleware to the top of the [middleware property](https://laravel.com/docs/5.8/middleware#global-middleware) in Laravel so that this is the first middleware for every request entering the application:

```
protected $middleware = [
    \KevinSmith\SameSiteNoneCompat\Laravel\SameSiteNoneMiddleware::class,
    // all other middleware...
];
```

Then update `config/session.php` to enable secure cookies and set the `same_site` config to `'none'`. Note that it's important that both attributes are set correctly. Cookies marked as `SameSite=None` that do not specify `Secure` will not work.

To check that it's working as expected, [inspect your cookies with Chrome](https://developers.google.com/web/tools/chrome-devtools/storage/cookies) and look for copies of all your cookies with the added suffix `__ssn-fallback`. And of course, you'll want to test this in all the browsers your audience uses to access your application.

License
-------

[](#license)

Copyright 2020 Kevin Smith

Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at

Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.

###  Health Score

28

—

LowBetter than 54% of packages

Maintenance20

Infrequent updates — may be unmaintained

Popularity19

Limited adoption so far

Community9

Small or concentrated contributor base

Maturity52

Maturing project, gaining track record

 Bus Factor1

Top contributor holds 100% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~0 days

Total

2

Last Release

2279d ago

### Community

Maintainers

![](https://www.gravatar.com/avatar/7358764d4fa43428d870fd432df278f299f095b8612c15394ed89ed45acc6688?d=identicon)[kevinsmith](/maintainers/kevinsmith)

---

Top Contributors

[![kevinsmith](https://avatars.githubusercontent.com/u/397904?v=4)](https://github.com/kevinsmith "kevinsmith (9 commits)")

---

Tags

compatibility-layercookieslaravellaravel-packagemiddlewaresamesitesamesite-cookiesmiddlewarelaravellaravel-packagecookiessamesitesamesite cookiescompatibility-layer

###  Code Quality

TestsPHPUnit

Code StylePHP CS Fixer

### Embed Badge

![Health badge](/badges/kevinsmith-laravel-samesite-none-compat/health.svg)

```
[![Health](https://phpackages.com/badges/kevinsmith-laravel-samesite-none-compat/health.svg)](https://phpackages.com/packages/kevinsmith-laravel-samesite-none-compat)
```

###  Alternatives

[timacdonald/has-parameters

A trait that allows you to pass arguments to Laravel middleware in a more PHP'ish way.

228271.7k2](/packages/timacdonald-has-parameters)[imanghafoori/laravel-nullable

A package to help you write expressive defensive code in a functional manner

151423.7k6](/packages/imanghafoori-laravel-nullable)[paxha/laravel-reportable

This Laravel Eloquent extension provides record according to dates using models.

111.2k](/packages/paxha-laravel-reportable)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
