PHPackages jiten14/jitone-ai - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Utility & Helpers](/categories/utility) 4. / 5. jiten14/jitone-ai ActiveLibrary[Utility & Helpers](/categories/utility) jiten14/jitone-ai ================= jitone-ai is a powerful FilamentPHP plugin that integrates AI-powered features directly into your Filament forms. v0.1.9(2mo ago)213.1k↓31.8%12MITPHPPHP ^8.2CI passing Since Sep 8Pushed 11mo ago3 watchersCompare [ Source](https://github.com/jiten14/jitone-ai)[ Packagist](https://packagist.org/packages/jiten14/jitone-ai)[ Docs](https://github.com/jiten14/jitone-ai)[ GitHub Sponsors](https://github.com/jiten14)[ RSS](/packages/jiten14-jitone-ai/feed)WikiDiscussions main Synced 1mo ago READMEChangelogDependencies (18)Versions (20)Used By (0) Jitone AI:- Build AI-powered Filament forms. ============================================ [](#jitone-ai--build-ai-powered-filament-forms) **jitone-ai is a powerful FilamentPHP plugin that integrates AI-powered features directly into your Filament forms.** **Unlock powerful features with the Pro version [here](https://jitoneai.lemonsqueezy.com/buy/a51ffb2d-2ad1-4565-af29-4eebc645b499).** **Limited-Time Offer:** For a short time, you can get 20% off your purchase by using the coupon code **SAVEPRO** at checkout. This offer is only available for a limited period. [![Latest Version on Packagist](https://camo.githubusercontent.com/bf77194c34dd5c0f7a0d93e3f7b6ac0a8cec07e2f2010dcf8e4fb6f26b167cbe/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f762f6a6974656e31342f6a69746f6e652d61692e7376673f7374796c653d666c61742d737175617265)](https://packagist.org/packages/jiten14/jitone-ai)[![GitHub Tests Action Status](https://camo.githubusercontent.com/6a96408907fab91d5400e85504c066c04cb7c14a7e1016f4201199746b52a9a1/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f616374696f6e732f776f726b666c6f772f7374617475732f6a6974656e31342f6a69746f6e652d61692f72756e2d74657374732e796d6c3f6272616e63683d6d61696e266c6162656c3d7465737473267374796c653d666c61742d737175617265)](https://github.com/jiten14/jitone-ai/actions?query=workflow%3Arun-tests+branch%3Amain)[![Total Downloads](https://camo.githubusercontent.com/8eca7c426cc4e8b09e8066c5401fe74aad87e23f63c660df058e0b73bb721aa8/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f64742f6a6974656e31342f6a69746f6e652d61692e7376673f7374796c653d666c61742d737175617265)](https://packagist.org/packages/jiten14/jitone-ai) Installation ------------ [](#installation) ``` composer require jiten14/jitone-ai ``` Usage ----- [](#usage) 1. After downloading, Run the package installation command: ``` php artisan jitone-ai:install ``` **This command will:** - Publish the configuration file for `Jitone AI` Settings. - Publish the configiration file for `openai-php/laravel` Settings. - Create a symbolic link for storage 2. We use [openai-php/laravel](https://github.com/openai-php/laravel) package to connect with OpenAI API. Blank environment variables for the OpenAI API key and organization id are already appended to your .env file, Add your API key here. ``` OPENAI_API_KEY=sk-... OPENAI_ORGANIZATION=org-... ``` Configuration ------------- [](#configuration) The `config/jitone-ai.php` file allows you to set default values and templates: - Set default AI models, max tokens, and temperature - Configure image generation settings - Add custom content templates Usage for Developers -------------------- [](#usage-for-developers) ### Adding AI to Built-in Filament Form Fields [](#adding-ai-to-built-in-filament-form-fields) You can add AI generation capabilities to `TextInput`, `Textarea`, and `RichEditor` fields using the `withAI()` method: #### Without Options [](#without-options) ``` use Filament\Forms\Components\TextInput; use Filament\Forms\Components\Textarea; use Filament\Forms\Components\RichEditor; TextInput::make('title') ->withAI() Textarea::make('description') ->withAI() RichEditor::make('content') ->withAI() ``` #### With Options [](#with-options) ``` TextInput::make('title') ->withAI([ 'model' => 'gpt-4', 'max_tokens' => 100, 'temperature' => 0.7, ]) Textarea::make('description') ->withAI([ 'model' => 'gpt-3.5-turbo', 'max_tokens' => 200, 'temperature' => 0.5, ]) RichEditor::make('content') ->withAI([ 'model' => 'gpt-4', 'max_tokens' => 500, 'temperature' => 0.8, ]) ``` ### Using Dedicated AI Fields [](#using-dedicated-ai-fields) #### AITextField [](#aitextfield) The package provides a dedicated `AITextField` for enhanced content generation: ##### Without Options: [](#without-options-1) ``` use Jiten14\JitoneAi\Forms\Components\AITextField; AITextField::make('content')->withAI() ``` ##### With Options: [](#with-options-1) ``` AITextField::make('content') ->withAI([ 'model' => 'gpt-4', 'max_tokens' => 300, 'temperature' => 0.6, ]) ``` #### AIFileUpload for Image Generation [](#aifileupload-for-image-generation) Use the `AIFileUpload` field with the `imageAI()` method to enable AI image generation: ##### Without Options: [](#without-options-2) ``` use Jiten14\JitoneAi\Forms\Components\AIFileUpload; AIFileUpload::make('image') ->imageAI() ``` ##### With Options: [](#with-options-2) ``` AIFileUpload::make('image') ->imageAI([ 'size' => '1024x1024', ]) ``` Usage for End-Users ------------------- [](#usage-for-end-users) ### Generating Content [](#generating-content) 1. In a form with AI-enabled fields, users will see a "Generate with AI" link right upper to the field. 2. Clicking this link opens a modal where users can: - Enter a custom prompt - Choose from pre-defined templates (if configured) - Use existing content for modification 3. If modifying existing content, users can choose to: - Refine: Improve the existing text - Expand: Add more details to the existing text - Shorten: Summarize the existing text 4. After entering the prompt, selecting a template, or choosing a modification option, click "Generate" to create or modify the content. 5. The generated or modified content will be inserted into the form field. ### Generating Images [](#generating-images) 1. For fields with AI image generation, users will see a "Generate with AI" link right upper to the upload field. 2. Clicking this link opens a modal where users can: - Describe the image they want to generate - Choose from pre-defined image prompts (if configured) - Select the desired image size (if multiple options are provided) 3. After entering the description, selecting a template, and choosing the size, click "Generate" to create the image. 4. The generated image will be uploaded and associated with the form field. Advanced Features ----------------- [](#advanced-features) - The package automatically checks for required dependencies and their versions, logging warnings if any are missing or outdated. - Developers can add custom templates and prompts through the configuration file. Changelog --------- [](#changelog) Jitone AI follows semantic versioning: - **v0.1.8**: Added support for openai-php/laravel 0.13 & above. Please see [CHANGELOG](CHANGELOG.md) for more information on what has changed recently. Contributing ------------ [](#contributing) Please see [CONTRIBUTING](.github/CONTRIBUTING.md) for details. FAQ --- [](#faq) 1. **File upload previews not loading after generating Image.** - **Ans.**- Make sure that the APP\_URL variable in your .env file matches the domain you're using to access your app from, including the protocol (http or https). Security Vulnerabilities ------------------------ [](#security-vulnerabilities) If you discover any security vulnerabilities or bugs, please let us know so I can address them promptly. Support ------- [](#support) For support with this package or to report any issues, feel free to reach out [Jitone AI Support](mailto:support@jiten.one). I am happy to assist you! πŸš€ Take Your Filament Forms to the Next Level β€” Upgrade to JitoneAI Pro ---------------------------------------------------------------------- [](#-take-your-filament-forms-to-the-next-level--upgrade-to-jitoneai-pro) If you're finding value in the free version of JitoneAI, the **Pro package is built to supercharge your workflow**. Designed for developers and teams who want more control, more capabilities, and more productivity β€” without reinventing the wheel. ### πŸ”“ What’s Inside JitoneAI Pro? [](#-whats-inside-jitoneai-pro) - ✨ **Custom AI Templates for Different User Roles** - 🧠 **Prompt Memory for Better Contextual Generation** - πŸ“Έ **Advanced Image Customization Tools** - πŸ’Ό **Multi-model Flexibility with Prioritized Fallbacks** - πŸ“Š **Usage Logs & Debug Tools for AI Requests** - πŸ› οΈ **Developer-First Hooks for Deep Customization** ### πŸ’‘ Why Go Pro? [](#-why-go-pro) You’ve already seen what JitoneAI can do β€” but the Pro version removes the ceiling. Whether you're building for clients, internal teams, or products at scale, JitoneAI Pro saves hours, reduces friction, and ensures production-grade flexibility. ### 🎯 Ideal For [](#-ideal-for) - Agencies building client portals with rich content automation - SaaS teams shipping AI-powered user experiences - Freelancers who want to deliver more β€” faster - Any developer who values performance and polish ### πŸ‘‰ Get JitoneAI Pro [](#-get-jitoneai-pro) For more details and to purchase **JitoneAI Pro**, visit the official Filament plugin page: **** **Own your AI workflow. Ship faster. Upgrade with confidence.** Credits ------- [](#credits) - [Jitendriya Tripathy](https://github.com/jiten14) - [All Contributors](../../contributors) License ------- [](#license) The MIT License (MIT). Please see [License File](LICENSE.md) for more information. ### Health Score 44 β€” FairBetter than 92% of packages Maintenance67 Regular maintenance activity Popularity33 Limited adoption so far Community12 Small or concentrated contributor base Maturity51 Maturing project, gaining track record Bus Factor1 Top contributor holds 100% of commits β€” single point of failure How is this calculated?**Maintenance (25%)** β€” Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** β€” Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** β€” Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** β€” Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~30 days Recently: every ~126 days Total 19 Last Release 68d ago PHP version history (3 changes)v0.0.1-alphaPHP ^8.1 v0.1.8PHP ^8.1 || ^8.2 v0.1.9PHP ^8.2 ### Community Maintainers ![](https://www.gravatar.com/avatar/31d7aa4d0dd752c5304b457db0c3c4648424d783cc568dd5d98fb86bedb50ee5?d=identicon)[jiten14](/maintainers/jiten14) --- Top Contributors [![jiten14](https://avatars.githubusercontent.com/u/8677979?v=4)](https://github.com/jiten14 "jiten14 (39 commits)") --- Tags ai-content-generationai-image-generationfilament-pluginfilamentphplaravel-packagelaravellaravel-packagefilament-pluginfilamentphpjiten14jitone-aiai-image-generationai-content-generation ### Code Quality TestsPest ### Embed Badge ![Health badge](/badges/jiten14-jitone-ai/health.svg) ``` [![Health](https://phpackages.com/badges/jiten14-jitone-ai/health.svg)](https://phpackages.com/packages/jiten14-jitone-ai) ``` ### Alternatives [schmeits/filament-character-counter This is a Filament character counter TextField and Textarea form field for Filament v4 and v5 33184.7k6](/packages/schmeits-filament-character-counter)[bezhansalleh/filament-google-analytics Google Analytics integration for FilamentPHP 205144.8k5](/packages/bezhansalleh-filament-google-analytics)[dotswan/filament-map-picker Easily pick and retrieve geo-coordinates using a map-based interface in your Filament applications. 124139.3k2](/packages/dotswan-filament-map-picker)[jaocero/radio-deck Turn filament default radio button into a selectable card with icons, title and description. 83281.2k5](/packages/jaocero-radio-deck)[defstudio/filament-searchable-input A searchable autocomplete input for Filament forms 3212.4k](/packages/defstudio-filament-searchable-input)[jibaymcs/filament-tour Bring the power of DriverJs to your Filament panels and start a tour ! 12247.8k](/packages/jibaymcs-filament-tour) PHPackages Β© 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)