PHPackages happytodev/blogr - PHPackages - PHPackages [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register) 1. [Directory](/) 2. / 3. [Utility & Helpers](/categories/utility) 4. / 5. happytodev/blogr ActiveLibrary[Utility & Helpers](/categories/utility) happytodev/blogr ================ Blogr is a FilamentPHP plugin that adds a powerful blog system to your Laravel application. 2.2.4(1w ago)203502[34 issues](https://github.com/happytodev/blogr/issues)4MITPHPPHP ^8.3CI passing Since Aug 16Pushed 1mo agoCompare [ Source](https://github.com/happytodev/blogr)[ Packagist](https://packagist.org/packages/happytodev/blogr)[ Docs](https://github.com/happytodev/blogr)[ GitHub Sponsors](https://github.com/happytodev)[ RSS](/packages/happytodev-blogr/feed)WikiDiscussions main Synced 1w ago READMEChangelog (10)Dependencies (200)Versions (153)Used By (4) Blogr — Multilingual Blog Plugin for FilamentPHP ================================================ [](#blogr--multilingual-blog-plugin-for-filamentphp) [![Latest Version](https://camo.githubusercontent.com/cb31d8ad78205f4f22a25da16dd73da432ab4266c00a002fc3f47e9daa8a8387/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f762f6861707079746f6465762f626c6f67722e7376673f7374796c653d666c61742d737175617265)](https://packagist.org/packages/happytodev/blogr)[![Tests](https://camo.githubusercontent.com/fdf32776677d790504c2ffe1504015af30e14375506cc07093cacb37886fe765/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f616374696f6e732f776f726b666c6f772f7374617475732f6861707079746f6465762f626c6f67722f72756e2d74657374732e796d6c3f6272616e63683d6d61696e266c6162656c3d7465737473267374796c653d666c61742d737175617265)](https://github.com/happytodev/blogr/actions?query=workflow%3Arun-tests+branch%3Amain)[![PHP Version](https://camo.githubusercontent.com/54cb9ea79a857ca8f65d05dfdb86075e2ae7be03c798762ef669fbb1c03db797/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f7068702d762f6861707079746f6465762f626c6f67723f7374796c653d666c61742d737175617265)](https://packagist.org/packages/happytodev/blogr)[![Downloads](https://camo.githubusercontent.com/5638744db03dbdc56547d555b457e003823a98b8553e77a09a296dbbc37c007a/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f64742f6861707079746f6465762f626c6f67722e7376673f7374796c653d666c61742d737175617265)](https://packagist.org/packages/happytodev/blogr)[![GitHub Stars](https://camo.githubusercontent.com/bd36c75cac74fbacb4f10740ae8f2a206e87829d9fbefaafce7616b17d0b1a28/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f73746172732f6861707079746f6465762f626c6f67723f7374796c653d666c61742d737175617265)](https://github.com/happytodev/blogr)[![License](https://camo.githubusercontent.com/458425f8985b0b0c8a736cffe75e05a098e3d77906acddbcad2bfc54492a4e02/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f4c6963656e73652d4d49542d677265656e2e7376673f7374796c653d666c61742d737175617265)](https://opensource.org/licenses/MIT)[![WCAG 2.2 AA](https://camo.githubusercontent.com/39e229dcc34b4f06739969d5ee0256e5b9c55d29aa5677b572ae7358cbed321a/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f574341472d322e3225323041412d737563636573733f7374796c653d666c61742d737175617265)](https://www.w3.org/TR/WCAG22/) [![Blogr Banner](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/blogr.webp)](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/blogr.webp) **A production-ready, multilingual blog and CMS system for Laravel & FilamentPHP v4.** [Features](#-key-features) • [Installation](#-quick-start) • [Documentation](#-documentation) • [Screenshots](#-screenshots) • [Support](#-support) --- ✨ Overview ---------- [](#-overview) Blogr turns your Laravel application into a full-featured blogging platform. Built as a FilamentPHP v4 plugin, it provides a translation-first content engine, a visual CMS page builder, role-based authoring, SEO tools, analytics integration, and a modern frontend with dark mode and theme presets — all configurable from a single admin settings page. ### Why Blogr? [](#why-blogr) - 🌍 **Translation-First** — Posts, series, categories, tags, CMS pages, and author bios are fully translatable. - 🧱 **Visual CMS Builder** — Build static pages with 23 block types, 7 templates, and gradient-aware transitions. - 🎨 **Theme System** — Light/dark/auto mode, 5 color presets, 16+ configurable colors, custom fonts. - 🔌 **Extensible** — Plugin architecture via `BlogrExtension` for third-party packages. - 🔍 **SEO Ready** — Meta tags, Open Graph, Twitter Cards, JSON-LD, XML sitemaps, RSS feeds, hreflang. - 📊 **Dashboard Widgets** — 9 widgets including stats, charts, scheduled posts, SEO checklist, and more. - 🧪 **Battle Tested** — 1,366+ automated tests covering every major feature. - ♿ **Accessible** — WCAG 2.2 AA compliant: skip navigation, keyboard-operable galleries, carousels and mega menus, descriptive link labels, screen-reader-friendly status messages, form autocomplete, focus management, minimum touch targets, visible focus indicators, accessible icon labels, and color contrast validation in admin settings. --- 🎯 Key Features -------------- [](#-key-features) ### ✍️ Blog Engine [](#️-blog-engine) - Translation-first architecture (main entity + translation tables) - Markdown content with Prism.js syntax highlighting - Video embeds (YouTube, Vimeo, Dailymotion) - Post scheduling (draft / scheduled / published) - Categories and tags with inline creation - Reading time calculation - Auto-generated table of contents - Heading permalinks with copy-to-clipboard - TL;DR summaries - Featured images with fallback ### 📚 Blog Series [](#-blog-series) - Group posts into numbered series - Automatic prev/next navigation - Custom or auto position ordering - Featured series highlighting - Multiple authors per series - Translated slugs ### 🌍 Multilingual [](#-multilingual) - Built-in support for 24+ locales - Localized routes (`/{locale}/blog/...`) - Locale auto-detection from published content - Locale disable/restrict per language - Language switcher component - Hreflang SEO tags ### 📄 CMS Pages [](#-cms-pages) - 7 templates: Default, Landing, Contact, About, Pricing, FAQ, Custom - 23 block types (see [CMS Blocks](#-cms-blocks)) - Block hide/show toggle - Per-page version history and drafts - Preview mode with signed URL - Anti-collision reserved slugs - Set any page as homepage ### 🎨 Theming & UI [](#-theming--ui) - 5 color presets (Magenta, Ocean, Emerald, Sunset, Slate) - 16+ configurable color pickers - CSS custom properties - Back-to-top button - Mega menu and navigation builder - Sticky navigation, logo, footer - 9 social link slots ### 🔍 SEO & Syndication [](#-seo--syndication) - Meta title/description/keywords per post/page - Open Graph and Twitter Cards - Schema.org Article / Organization / BreadcrumbList - XML sitemap (`/sitemap.xml`) - RSS feeds (main, category, tag) - Canonical URLs and robots meta ### ⚙️ Admin Experience [](#️-admin-experience) - Filament v4 native integration - Global search across posts, pages, and users - Sortable tables with filters and toggleable columns - Admin notifications when writers save posts - Centralized settings page with 85+ fields - Auto-save for posts and CMS pages --- 📸 Screenshots ------------- [](#-screenshots) **Admin Dashboard**[![Blogr Dashboard](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/image-5.png)](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/image-5.png) **Post Editor**[![Blogr Post Editor](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/image-3.png)](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/image-3.png) **Frontend Blog Home**[![Blogr Home](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/blogr-home.png)](https://raw.githubusercontent.com/happytodev/blogr/main/.github/images/blogr-home.png) > More screenshots are available in the [`.github/images`](https://github.com/happytodev/blogr/tree/main/.github/images) folder on GitHub. --- 🚀 Quick Start ------------- [](#-quick-start) ### Prerequisites [](#prerequisites) - PHP 8.3+ - Laravel 12.x - FilamentPHP v4.x - Composer - Node.js 18+ and npm ### Install in a fresh Laravel + Filament project [](#install-in-a-fresh-laravel--filament-project) ``` # 1. Create a Laravel project laravel new my-blog cd my-blog # 2. Install FilamentPHP composer require filament/filament php artisan filament:install --panels # 3. Create an admin user php artisan make:filament-user # 4. Install Blogr composer require happytodev/blogr php artisan blogr:install ``` The installer will ask a few questions (CMS enabled, homepage type, admin path, theme setup, tutorials, demo pages) and then publish configs, run migrations, configure your User model, install frontend assets, and build everything. ### After installation [](#after-installation) 1. Log in at `/admin` (or your configured admin path). 2. Go to **Blog Posts → New Post** to create content. 3. Visit **Blogr Settings** to customize appearance, SEO, navigation, and analytics. 4. View your blog at `/blog` or `/` if you set the blog as homepage. For a detailed walkthrough, see [INSTALL.md](INSTALL.md). --- 🛠️ CLI Commands --------------- [](#️-cli-commands) Blogr ships with several Artisan commands: CommandDescription`php artisan blogr:install`Interactive installer (recommended)`php artisan blogr:install-tutorials`Install tutorial posts`php artisan blogr:remove-tutorials`Remove tutorial posts`php artisan blogr:list-tutorials`List available tutorials`php artisan blogr:publish-demo-pages`Publish Home + Contact demo CMS pages`php artisan blogr:export`Export posts, series, categories, tags, users, CMS pages`php artisan blogr:import {file}`Import from JSON or ZIP export`php artisan blogr:sync-admin-path`Sync the admin panel path after changing it`php artisan blogr:migrate-translations`Migrate legacy posts to translation-first schema`php artisan blogr:install-user-management`Install User resource stubs and permissions--- ⚙️ Configuration Highlights --------------------------- [](#️-configuration-highlights) All settings are manageable from the **Blogr Settings** page in the admin panel, or directly in `config/blogr.php`. ### Routes and homepage [](#routes-and-homepage) ``` 'route' => [ 'prefix' => 'blog', // Change to '' for homepage 'frontend' => ['enabled' => true], 'middleware' => ['web'], ], 'homepage' => [ 'type' => 'blog', // 'blog' or 'cms' ], ``` ### Locales [](#locales) ``` 'locales' => [ 'enabled' => true, 'default' => 'en', 'available' => ['en', 'fr'], 'auto_detect' => false, ], ``` ### CMS pages [](#cms-pages) ``` 'cms' => [ 'enabled' => true, 'prefix' => '', // '', 'page', 'pages', etc. 'templates' => [ 'default', 'landing', 'contact', 'about', 'pricing', 'faq', 'custom' ], ], ``` ### SEO defaults [](#seo-defaults) ``` 'seo' => [ 'site_name' => ['en' => 'The blog', 'fr' => 'Le blog'], 'default_title' => ['en' => 'Blog', 'fr' => 'Blog'], 'twitter_handle' => '@yourhandle', 'og' => [ 'image' => '/images/blogr.webp', 'image_width' => 1200, 'image_height' => 630, ], 'structured_data' => [ 'enabled' => true, 'organization' => [ 'name' => env('APP_NAME'), 'url' => env('APP_URL'), 'logo' => env('APP_URL').'/images/logo.png', ], ], ], ``` ### Analytics [](#analytics) ``` 'analytics' => [ 'enabled' => false, 'provider' => null, // 'google', 'plausible', 'umami', 'matomo' 'google' => ['measurement_id' => 'G-XXXXXXXXXX'], 'plausible' => ['domain' => 'yoursite.com'], 'umami' => ['website_id' => null, 'src' => null], 'matomo' => ['url' => null, 'site_id' => null], ], ``` --- 📊 Dashboard Widgets ------------------- [](#-dashboard-widgets) Nine widgets are available and can be enabled or disabled from **Settings → Dashboard**: WidgetDescription`BlogStatsOverview`Total, published, draft, scheduled posts + categories, tags, series, CMS pages`RecentBlogPosts`Latest posts with edit actions, filters, and column toggles`ScheduledPosts`Upcoming scheduled publications`BlogPostsChart`Post creations and publications over the last 12 months`BlogReadingStats`Reading time distribution (average, short, medium, long)`CategoryPostsChart`Doughnut chart of posts per category`SeriesStatsOverview`Series metrics overview`WeeklyActivityChart`Weekly publishing activity bar chart`MissingSeoAlert`SEO checklist alerting missing metadata--- 🧩 CMS Blocks ------------ [](#-cms-blocks) The CMS page builder includes 23 block types: **Content & Marketing** - Hero Banner - Hero Carousel - Features Grid - Call to Action - Rich Content (Markdown) - Blog Posts - Blog Title **Social Proof & Info** - Testimonials - Team Members - Stats & Metrics - Timeline - FAQ Accordion **Interactive & Media** - Image Gallery - Video Embed - Map - Contact Form - Newsletter **Decorative & Layout** - Wave Separator - Section Separator (diagonal) - Transition: Clip Path - Transition: Simple - Transition: Animation Each block supports 5 background types (none, solid, gradient, image, pattern), independent dark-mode settings, custom colors, and text shadows. --- Plugins ------- [](#plugins) Blogr supports third-party plugins via the `BlogrExtension` interface. Plugins can register routes, Livewire components, custom link types, and settings pages. ``` use Happytodev\Blogr\Contracts\BlogrExtension; use Happytodev\Blogr\Services\ExtensionRegistry; class MyPlugin implements BlogrExtension { public function getId(): string { return 'my-plugin'; } public function getName(): string { return 'My Plugin'; } public function getDescription(): string { return 'What it does.'; } public function getVersion(): string { return '1.0.0'; } public function getAuthor(): string { return 'Your Name'; } public function getHomepage(): ?string { return null; } public function getDependencies(): array { return []; } public function getSettingsUrl(): ?string { return null; } public function registerExtension(ExtensionRegistry $registry): void {} } ``` Register your plugin in your service provider: ``` public function packageBooted(): void { if ($this->app->has(ExtensionRegistry::class)) { $this->app->make(ExtensionRegistry::class)->register(new MyPlugin); } } ``` PluginDescriptionRepositoryGDPRCookie consent, privacy policy, data export and erasure[happytodev/blogr-gdpr](https://github.com/happytodev/blogr-gdpr)CommentsThreaded comments with moderation, voting, anti-spam, and email notifications[happytodev/blogr-comments](https://github.com/happytodev/blogr-comments)Artist PortfolioArtist portfolio with artwork management, portfolio pages, and commission showcase[happytodev/blogr-artist](https://github.com/happytodev/blogr-artist)--- 🛡️ Security ----------- [](#️-security) ### Configurable admin path [](#configurable-admin-path) Change the default `/admin` URL from **Settings → Admin Panel**, then run: ``` php artisan blogr:sync-admin-path ``` You can also set it via `.env`: ``` BLOGR_ADMIN_PATH=backoffice ``` ### Two-Factor Authentication [](#two-factor-authentication) Add 2FA to your admin panel with [Filament Breezy](https://github.com/jeffgreco13/filament-breezy). Blogr provides an installer command: ``` php artisan blogr:install-breezy ``` See the Breezy documentation for full configuration details. ### Roles and permissions [](#roles-and-permissions) Blogr uses Spatie Permission with two default roles: - **Admin** — full access - **Writer** — can create and edit own posts, cannot publish or manage other users --- 🧪 Testing --------- [](#-testing) Blogr is tested with **1,266 Pest PHP tests** covering import/export, multilingual routing, CMS pages, blocks, SEO, widgets, permissions, and more. ``` cd vendor/happytodev/blogr ./vendor/bin/pest --parallel ``` CI runs on GitHub Actions with PHP 8.4, Laravel 12, and `prefer-stable`. --- 📚 Documentation --------------- [](#-documentation) - [Installation Guide](INSTALL.md) - [Feature Overview](docs/FEATURES_v100.md) - [CMS Pages in Navigation](docs/CMS_PAGES_IN_NAVIGATION.md) - [Theme Switcher](docs/THEME_SWITCHER.md) - [RSS Feeds](docs/RSS_FEED.md) - [Language Switcher Fix](docs/LANGUAGE_SWITCHER_CMS_PAGE_FIX.md) - [Full docs folder](docs/) --- 🤝 Support --------- [](#-support) ### Need Help? [](#need-help) [📖 Full Documentation](https://github.com/happytodev/blogr#readme) • [🐛 Report Bug](https://github.com/happytodev/blogr/issues) • [💡 Request Feature](https://github.com/happytodev/blogr/issues/new) ### Love Blogr? [](#love-blogr) [![GitHub Sponsors](https://camo.githubusercontent.com/e11de82ac66c5e2a8b6e0d36bc5195a221cbcae5a82c0bdb88f264720fcce143/68747470733a2f2f696d672e736869656c64732e696f2f62616467652f53706f6e736f722d2545322539442541342d70696e6b3f7374796c653d666f722d7468652d6261646765266c6f676f3d676974687562)](https://github.com/sponsors/happytodev)[![Star on GitHub](https://camo.githubusercontent.com/19b48513748ca29e71b31129084284d9232bef5f6c28216770d82372a6f5aee2/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f73746172732f6861707079746f6465762f626c6f67723f7374796c653d666f722d7468652d6261646765266c6f676f3d676974687562)](https://github.com/happytodev/blogr/stargazers) --- 📄 License --------- [](#-license) **MIT License** — See [LICENSE.md](LICENSE.md) for details. Created with ❤️ by [Frédéric Blanc](https://github.com/happytodev) and the Laravel community. --- **[⬆ Back to Top](#blogr--multilingual-blog-plugin-for-filamentphp)** Made with ❤️ using Laravel & FilamentPHP ### Health Score 50 — FairBetter than 95% of packages Maintenance74 Regular maintenance activity Popularity24 Limited adoption so far Community20 Small or concentrated contributor base Maturity70 Established project with proven stability Bus Factor1 Top contributor holds 97.6% of commits — single point of failure How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window. **Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores. **Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement. **Maturity (30%)** — Project age, version count, PHP version support, and release stability. ### Release Activity Cadence Every ~2 days Total 150 Last Release 12d ago Major Versions 0.24.1 → 1.0.02026-06-07 1.32.0 → 2.0.02026-07-07 PHP version history (2 changes)v0.1.0PHP ^8.1 0.5.0PHP ^8.3 ### Community Maintainers ![](https://www.gravatar.com/avatar/b31cd186f639bcfaffa668063556cfe495baae03d56a7f0c69fba8383feecfc1?d=identicon)[happytodev](/maintainers/happytodev) --- Top Contributors [![happytodev](https://avatars.githubusercontent.com/u/425998?v=4)](https://github.com/happytodev "happytodev (1276 commits)")[![github-actions[bot]](https://avatars.githubusercontent.com/in/15368?v=4)](https://github.com/github-actions[bot] "github-actions[bot] (26 commits)")[![nexxai](https://avatars.githubusercontent.com/u/4316564?v=4)](https://github.com/nexxai "nexxai (3 commits)")[![Copilot](https://avatars.githubusercontent.com/in/1143301?v=4)](https://github.com/Copilot "Copilot (1 commits)")[![f-blanc](https://avatars.githubusercontent.com/u/147386903?v=4)](https://github.com/f-blanc "f-blanc (1 commits)") --- Tags blogenginecmsfilamentphplaravellaravelfilamentphphappytodevblogr ### Code Quality TestsPest Static AnalysisPHPStan Code StyleLaravel Pint ### Embed Badge ![Health badge](/badges/happytodev-blogr/health.svg) ``` [![Health](https://phpackages.com/badges/happytodev-blogr/health.svg)](https://phpackages.com/packages/happytodev-blogr) ``` ### Alternatives [filament/filament A collection of full-stack components for accelerated Laravel app development. 3932.5M4.3k](/packages/filament-filament)[relaticle/flowforge Flowforge is a lightweight Kanban board package for Filament that works with existing Eloquent models. 415139.6k11](/packages/relaticle-flowforge)[filament/infolists Easily add beautiful read-only infolists to any Livewire component. 1330.7M77](/packages/filament-infolists)[filament/forms Easily add beautiful forms to any Livewire component. 4834.0M470](/packages/filament-forms)[backstage/mails View logged mails and events in a beautiful Filament UI. 16429.7k](/packages/backstage-mails)[rawilk/profile-filament-plugin Profile & MFA starter kit for filament. 3915.5k](/packages/rawilk-profile-filament-plugin) PHPackages © 2026 [Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)