PHPackages                             ellaisys/aws-cognito - PHPackages - PHPackages  [Skip to content](#main-content)[PHPackages](/)[Directory](/)[Categories](/categories)[Trending](/trending)[Leaderboard](/leaderboard)[Changelog](/changelog)[Analyze](/analyze)[Collections](/collections)[Log in](/login)[Sign up](/register)

1. [Directory](/)
2. /
3. [Authentication &amp; Authorization](/categories/authentication)
4. /
5. ellaisys/aws-cognito

ActiveLibrary[Authentication &amp; Authorization](/categories/authentication)

ellaisys/aws-cognito
====================

Laravel Authentication using AWS Cognito (Web and API)

v2.0.6(5d ago)123256.9k↓50.6%57[7 issues](https://github.com/ellaisys/aws-cognito/issues)[3 PRs](https://github.com/ellaisys/aws-cognito/pulls)1MITPHPPHP ^7.4|^8.0

Since Oct 2Pushed 2w ago3 watchersCompare

[ Source](https://github.com/ellaisys/aws-cognito)[ Packagist](https://packagist.org/packages/ellaisys/aws-cognito)[ Docs](https://ellaisys.github.io/aws-cognito/)[ RSS](/packages/ellaisys-aws-cognito/feed)WikiDiscussions master Synced 2d ago

READMEChangelog (10)Dependencies (20)Versions (66)Used By (1)

[![Laravel AWS Cognito Package for IAM](./assets/images/banner.png)](./assets/images/banner.png)

Laravel Authentication using AWS Cognito (Web + API)
====================================================

[](#laravel-authentication-using-aws-cognito-web--api)

Supports: Multi-Factor Authentication (MFA) + FIDO2 (Passkey) + SRP Authentication + Device Authentication

[![Release Version](https://camo.githubusercontent.com/85a21932325f0dcb39763e44c1f0b4b8d48152bac0ec64a44922af6b0771d8b3/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f762f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d7061636b6167697374266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d52656c6561736525433225413056657273696f6e)](https://packagist.org/packages/ellaisys/aws-cognito#v1.1.3) [![Release Date](https://camo.githubusercontent.com/adea13562421753a96cb035f5f529b16265645075649dd0a06fa7e6c10207f36/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f72656c656173652d646174652f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d7061636b6167697374266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d52656c6561736525433225413044617465)](https://packagist.org/packages/ellaisys/aws-cognito) [![Total Downloads](https://camo.githubusercontent.com/01adfe62cb8ecd3dde4706503a31302d008a3a9b188e1bcf8fc8c26ad8266323/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f64742f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d7061636b6167697374266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d446f776e6c6f616473)](https://packagist.org/packages/ellaisys/aws-cognito)

[![Github Stars](https://camo.githubusercontent.com/34cbb11b3e5603691cd7bee430c5a6324c6bb5f12e09695e47aafba79ae33675/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f73746172732f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d5374617273)](https://camo.githubusercontent.com/34cbb11b3e5603691cd7bee430c5a6324c6bb5f12e09695e47aafba79ae33675/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f73746172732f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d5374617273) [![Github Forks](https://camo.githubusercontent.com/9d0f11f51fb264dc4267d7ec62210463f883ead92bcded21ca0ad90afd8cb869/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f666f726b732f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d466f726b73)](https://camo.githubusercontent.com/9d0f11f51fb264dc4267d7ec62210463f883ead92bcded21ca0ad90afd8cb869/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f666f726b732f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d466f726b73) [![GitHub Contributors](https://camo.githubusercontent.com/45a5476519c81a03969e26837bea2bb967ad2afc4bf6f04b479868e694d0c311/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f636f6e7472696275746f72732d616e6f6e2f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d436f6e7472696275746f7273)](CONTRIBUTING.md) [![APM](https://camo.githubusercontent.com/137b17b277ac5dac3d9aeac7c2b5a0a647fd1b1a8689216fb3030f4c995af98f/68747470733a2f2f696d672e736869656c64732e696f2f7061636b61676973742f6c2f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c61742d737175617265266c6f676f3d676974687562266c6f676f436f6c6f723d7768697465736d6f6b65266c6162656c3d4c6963656e7365)](LICENSE.md)

[![Quality Gate Status](https://camo.githubusercontent.com/4db9da3fdbac18cf119a320eb7bdfe0595f51cb2ac7b84292dc6e7f798ee2edd/68747470733a2f2f736f6e6172636c6f75642e696f2f6170692f70726f6a6563745f6261646765732f6d6561737572653f70726f6a6563743d656c6c61697379735f6177732d636f676e69746f266d65747269633d616c6572745f737461747573)](https://sonarcloud.io/summary/new_code?id=ellaisys_aws-cognito)[![Security Rating](https://camo.githubusercontent.com/c867ee9a5d3fea270c919d831a2ea2951c88b8f5bfeebe67e2d1067204f8ce41/68747470733a2f2f736f6e6172636c6f75642e696f2f6170692f70726f6a6563745f6261646765732f6d6561737572653f70726f6a6563743d656c6c61697379735f6177732d636f676e69746f266d65747269633d73656375726974795f726174696e67)](https://sonarcloud.io/summary/new_code?id=ellaisys_aws-cognito)[![Maintainability Rating](https://camo.githubusercontent.com/854c86ffd6d68752f20b3ac80b25003f75f79bf69f017642c7ca530c4d25ec02/68747470733a2f2f736f6e6172636c6f75642e696f2f6170692f70726f6a6563745f6261646765732f6d6561737572653f70726f6a6563743d656c6c61697379735f6177732d636f676e69746f266d65747269633d7371616c655f726174696e67)](https://sonarcloud.io/summary/new_code?id=ellaisys_aws-cognito)

This package provides a simple way to use AWS Cognito authentication in Laravel for Web and API Auth Drivers. The idea of this package, and some of the code, is based on the package from Pod-Point which you can find here: [Pod-Point/laravel-cognito-auth](https://github.com/Pod-Point/laravel-cognito-auth), [black-bits/laravel-cognito-auth](https://github.com/black-bits/laravel-cognito-auth) and [tymondesigns/jwt-auth](https://github.com/tymondesigns/jwt-auth).

**[DEMO Application](https://demo.ellaisys.com/cognito)**. You can try and register and login. For the first time, it will force the user to change password. The **[source code](https://github.com/ellaisys/demo_cognito_app)** of the demo application is also available of the GitHub.

We decided to use it and contribute it to the community as a package, that encourages standarised use and a RAD tool for authentication using AWS Cognito.

Features
--------

[](#features)

- [Registration and Confirmation E-Mail (Sign Up)](#registering-users)
- Forced password change at first login (configurable)
- [Login (Sign In)](#user-authentication)
- Token Validation for all Session and Token Guard Requests
- Remember Me Cookie
- Single Sign On (Fix: Issue #86)
- Forgot Password (Resend - configurable)
- User Deletion
- Edit User Attributes
- Reset User Password
- Confirm Sign Up
- Easy API Token handling (uses the cache driver)
- [DynamoDB support for Web Sessions and API Tokens (useful for server redundency OR multiple containers)](#storing-web-sessions-or-api-tokens-in-dynamodb-useful-for-multiservercontainer-implementation)
- Easy configuration of Token Expiry (Manage using the cognito console, no code or configurations needed)
- Support for App Client without Secret
- Support for Cognito Groups, including assigning a default group to a new user
- Session (Web) now has AccessToken and RefreshToken as part of the claim object
- [Refresh Token API](#refresh-token)
- [Logout (Sign Out) - Remove access tokens from AWS](#signout-remove-access-token)
- [Forced Logout (Sign Out) - Revoke the RefreshToken from AWS](#signout-remove-access-token)
- [MFA Implementation for Session and Token Guards](./docs/README_MFA.md) **Updated**
- [Password validation based on Cognito Configuration](#password-validation-based-of-cognito-configuration)
- [Mapping Cognito User using Subject UUID](#mapping-cognito-user-using-subject-uuid)
- [Preconfigured routes and controllers for Web and API ](./docs/README_ROUTES.md#routes)
- [Preconfigured views for Web ](./docs/README_ROUTES.md#web-views-and-components)
- [FIDO2 Security Keys Passkey](./docs/README_FIDO2.md) **Updated**
- [SRP Authentication](./docs/README_SRP.md) **New Feature**
- [Device Authentication](./docs/README_DEVICE_AUTH.md) **New Feature**

Compatability
-------------

[](#compatability)

PHP VersionSupport7.4Yes ✔️8.0Yes ✔️8.1Yes ✔️8.24Yes ✔️Laravel VersionSupport7.xYes ✔️8.xYes ✔️9.xYes ✔️10.xYes ✔️[11.x](#laravel-110-and-above-updated)Yes ✔️12.xYes ✔️Important

The middleware configurtion in Laravel 11.x and above shall need a configuration. Refer [\### Laravel 11.0 and above **Updated**](#laravel-110-and-above-updated)

Installation
------------

[](#installation)

You can install the package via composer.

```
composer require ellaisys/aws-cognito
```

### Laravel 5.4 and before

[](#laravel-54-and-before)

Using a version prior to Laravel 5.5 you need to manually register the service provider.

```
    // bootstrap/app.php
    'providers' => [
        ...
        Ellaisys\Cognito\Providers\AwsCognitoServiceProvider::class,

    ];
```

### Configuration File: Next you can publish the config.

[](#configuration-file-next-you-can-publish-the-config)

```
    php artisan vendor:publish --provider="Ellaisys\Cognito\Providers\AwsCognitoServiceProvider" --tag="config"
```

Last but not least you want to change the auth driver. To do so got to your config\\auth.php file and change it to look the following:

```
    'guards' => [
        'web' => [
            'driver' => 'cognito-session', // This line is important for using AWS Cognito as Web Driver
            'provider' => 'users',
        ],
        'api' => [
            'driver' => 'cognito-token', // This line is important for using AWS Cognito as API Driver
            'provider' => 'users',
        ],
    ],
```

Important

This is a new feature that is released in V1.2.0 and shall work with Laravel 8.37 (with anonymous migration support). For verions below Laravel 8.37, this feature is disabled. You will need to update the **users** table migration and add the **sub** column (type:string, nullable:yes, index:yes).

### Database Migrations

[](#database-migrations)

The AWS Cognito service provider registers its own database migration directory, so remember to migrate your database after installing the package. The AWS Cognito migrations will add a few columns to your **users** table:

```
    php artisan migrate
```

If you need to overwrite the migrations that ship with AWS Cognito, you can publish them using the vendor:publish Artisan command:

```
    php artisan vendor:publish --provider="Ellaisys\Cognito\Providers\AwsCognitoServiceProvider" --tag="migrations"
```

If you would like to prevent AWS Cognito's migrations from running entirely, you may use the ignoreMigrations method provided by AWS Cognito. Typically, this method should be called in the register method of your AppServiceProvider:

```
    use Ellaisys\Cognito\AwsCognito;

    /**
     * Register any application services.
     */
    public function register(): void
    {
        AwsCognito::ignoreMigrations();
    }
```

Cognito User Pool
-----------------

[](#cognito-user-pool)

In order to use AWS Cognito as authentication provider, you require a Cognito User Pool.

If you haven't created one already, go to your [Amazon management console](https://console.aws.amazon.com/cognito/home) and create a new user pool.

Next, generate an App Client. This will give you the App client id and the App client secret you need for your `.env` file.

*IMPORTANT: Don't forget to activate the checkbox to Enable sign-in API for server-based Authentication. The Auth Flow is called: ADMIN\_USER\_PASSWORD\_AUTH (formerly ADMIN\_NO\_SRP\_AUTH)*

### AWS IAM configuration

[](#aws-iam-configuration)

You also need a new **IAM Role** with the following Access Rights:

- AmazonCognitoDeveloperAuthenticatedIdentities
- AmazonCognitoPowerUser
- AmazonESCognitoAccess

From this IAM User you must use the **AWS\_ACCESS\_KEY\_ID** and **AWS\_SECRET\_ACCESS\_KEY** in the laravel environment file.

### Cognito configuration

[](#cognito-configuration)

Add the following fields to your `.env` file and set the values according to your AWS settings:

```
    # AWS configurations for cloud storage
    AWS_ACCESS_KEY_ID="Axxxxxxxxxxxxxxxxxxxxxxxx6"
    AWS_SECRET_ACCESS_KEY="mxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx+"

    # AWS Cognito configurations
    AWS_COGNITO_CLIENT_ID="6xxxxxxxxxxxxxxxxxxxxxxxxr"
    AWS_COGNITO_CLIENT_SECRET="1xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx1"
    AWS_COGNITO_USER_POOL_ID="xxxxxxxxxxxxxxxxx"
    AWS_COGNITO_REGION="xxxxxxxxxxx" //optional - default value is 'us-east-1'
    AWS_COGNITO_VERSION="latest" //optional - default value is 'latest'
```

Important

To sync the web session timeout with the cognito access token ttl value, set the **SESSION\_LIFETIME** parameter in the .env file. This value is in minutes with the default value being 120 mins i.e. 2 hours. This will ensure that the laravel session times out at the same time as the access token.

For more details on how to find AWS\_COGNITO\_CLIENT\_ID, AWS\_COGNITO\_CLIENT\_SECRET and AWS\_COGNITO\_USER\_POOL\_ID for your application, please refer [COGNITOCONFIG File](docs/COGNITOCONFIG.md)

### Importing existing users into the Cognito Pool

[](#importing-existing-users-into-the-cognito-pool)

If you are already working on an existing project and want to integrate Cognito you have to [import a user csv file to your Cognito Pool](https://docs.aws.amazon.com/cognito/latest/developerguide/cognito-user-pools-using-import-tool.html).

Usage
-----

[](#usage)

Our package is providing you 10 traits you can just add to your Auth Controllers to get our package running.

- Ellaisys\\Cognito\\Auth\\AuthenticatesUsers
- Ellaisys\\Cognito\\Auth\\ConfirmsPasswords
- Ellaisys\\Cognito\\Auth\\RefreshToken
- Ellaisys\\Cognito\\Auth\\RegisterMFA
- Ellaisys\\Cognito\\Auth\\RegistersUsers
- Ellaisys\\Cognito\\Auth\\ResetsPasswords
- Ellaisys\\Cognito\\Auth\\RespondsMFAChallenge
- Ellaisys\\Cognito\\Auth\\SendsPasswordResetEmails
- Ellaisys\\Cognito\\Auth\\VerifiesEmails
- Ellaisys\\Cognito\\Auth\\WebAuthPasskey

In the simplest way you just go through your Auth Controllers and use these traits which are currently implemented in Laravel. The Controllers are now also provided and preconfigured with the traits. You can use them as they are or change them to fit your needs.

You can change structure to suit your needs. Please be aware of the @extend statement in the blade file to fit into your project structure.

Single Sign-On
--------------

[](#single-sign-on)

With our package and AWS Cognito we provide you a simple way to use Single Sign-Ons. For configuration options take a look at the config [cognito.php](/config/cognito.php).

When you want SSO enabled and a user tries to login into your application, the package checks if the user exists in your AWS Cognito pool. If the user exists, he will be created automatically in your database provided the `add_missing_local_user` is to `true`, and is logged in simultaneously.

That's what we use the fields `sso_user_model` and `cognito_user_fields` for. In `sso_user_model` you define the class of your user model. In most cases this will simply be *App\\Models\\User*.

With `cognito_user_fields` you can define the fields which should be stored in Cognito. Put attention here. If you define a field which you do not send with the Register Request this will throw you an InvalidUserFieldException and you won't be able to register.

Now that you have registered your users with their attributes in the AWS Cognito pool and your database and you want to attach a second app which should use the same pool. Well, that's actually pretty easy. You can use the API provisions that allows multiple projects to consume the same AWS Cognito pool.

\*IMPORTANT: if your users table has a password field you are not going to need this anymore. What you want to do is set this field to be nullable, so that users can be created without passwords. From now on, Passwords are stored in Cognito.

Any additional registration data you have, for example `firstname`, `lastname` needs to be added in [cognito.php](/config/cognito.php) cognito\_user\_fields config to be pushed to Cognito. Otherwise they are only stored locally and are not available if you want to use Single Sign On's.\*

Forgot password with resend option
----------------------------------

[](#forgot-password-with-resend-option)

In case the user has not activated the account, AWS Cognito as a default feature does not allow user of use the forgot password feature. We have introduced the AWS documented feature that allows the password to be resent.

We have made this configurable for the developers so that they can use it as per the business requirement. The configuration takes a boolean value. Default is true (allows resend of forgot password)

```
    AWS_COGNITO_ALLOW_FORGOT_PASSWORD_RESEND=true
```

Middleware configuration for API Routes **Updated**
---------------------------------------------------

[](#middleware-configuration-for-api-routes-updated)

for Laravel 10 and before: In case you are using this library as API driver, you can register the middleware into the kernal.php in the $routeMiddleware

```
    protected $routeMiddleware = [
        ...
        'aws-cognito' => \Ellaisys\Cognito\Http\Middleware\AwsCognitoAuthenticate::class
    ]
```

### Laravel 11.0 and above **Updated**

[](#laravel-110-and-above-updated)

With Laravel 11 and above the middleware congiguration is defined in the app.php in the bootstrap folder. Please configure as shown below

```
    // bootstrap/app.php
        ...
        ->withMiddleware(function (Middleware $middleware): void {
            ...
            $middleware->alias([
                ...
                'aws-cognito' => \Ellaisys\Cognito\Http\Middleware\AwsCognitoAuthenticate::class
            ]);
            ...
        })
        ...
```

To use the middleware into the **Web routes**, you can use the std auth middleware as shown below

```
    Route::middleware('auth')->get('user', 'NameOfTheController@functionName');
```

To use the middleware into the **API routes**, as shown below

```
    Route::middleware('aws-cognito')->get('user', 'NameOfTheController@functionName');
```

Registering Users
-----------------

[](#registering-users)

As a default, if you are registering a new user with Cognito, Cognito will send you an email during signUp that includes the username and temporary password for the users to verify themselves.

Using this library in conjunction with **AWS Lambda**, once can look to customize the email template and content. The email template can be text or html based. The Lambda code for not included in this code repository. You can create your own. Any object (array) that you pass to the registration method is transferred as is to the lambda function, we are not prescriptive about the attribute names.

We have made is very easy for anyone to use the default behaviour.

1. You don't need to create an extra field to store the verification token.
2. You don't have to bother about the Sessions or API tokens, they are managed for you. The session or token is managed via the standard mechanism of Laravel. You have the liberty to keep it where ever you want, no security loop holes.
3. If you use the trait provided by us 'Ellaisys\\Cognito\\Auth\\RegistersUsers', the code will be limited to just a few lines
4. if you are using the Laravel scafolding, then make the password nullable in DB or drop it from schema. Passwords will be only managed by AWS Cognito.

```
    use Ellaisys\Cognito\Auth\RegistersUsers;

    class UserController extends BaseController
    {
        use RegistersUsers;

        public function register(Request $request)
        {
            $validator = $request->validate([
                'name' => 'required|max:255',
                'email' => 'required|email|max:64|unique:users',
                'password' => 'sometimes|confirmed|min:6|max:64',
            ]);

            //Create credentials object
            $collection = collect($request->all());
            $data = $collection->only('name', 'email', 'password'); //passing 'password' is optional.

            //Register User in cognito
            if ($cognitoRegistered=$this->createCognitoUser($data)) {

                //If successful, create the user in local db
                User::create($collection->only('name', 'email'));
            } //End if

            //Redirect to view
            return view('login');
        }
    }
```

5. You don't need to turn off Cognito to send you emails. We rather propose the use of AWS Cognito or AWS SMS mailers, such that user credentials are always secure.
6. In case you want to suppress the mails to be sent to the new users, you can configure the parameter given below to skip welcome mails to new user registration. Default configuration shall send the welcome email.

```
    AWS_COGNITO_NEW_USER_MESSAGE_ACTION="SUPPRESS"
```

7. The configuration given below allows the new user's email address to be auto marked as verified.

```
    AWS_COGNITO_FORCE_NEW_USER_EMAIL_VERIFIED=true //optional - default value is false.
```

8. To assign a default group to a new user when registering set a name of the user group as per the configuration done via AWS Cognito Management Console. The default value is set to null.

```
    AWS_COGNITO_DEFAULT_USER_GROUP="Customers"
```

9. To enable custom password or user defined password, the below configuration if set to **true** will force the user to set the password during registration, else cognito will generate a random password and send over email and/or SMS based on the configurations.

```
    AWS_COGNITO_FORCE_NEW_USER_PASSWORD=true //optional - default value is false.
```

10. The registration process now allows two types of request, 'invite' and 'register'. The register is self registration and an verification email is sent to the user. The invite is sent from the admin and contains the temporary cedentials. The RegistersUsers Trait allows two methods invite and register respectively. The default method called in the trait is set to **register**. You can change the behaviour of the register method by setting following configuration.

```
    AWS_COGNITO_REGISTRATION_TYPE="register" //optional - the default type is invite
```

User Authentication
-------------------

[](#user-authentication)

We have provided you with a useful trait that make the authentication very simple (with Web or API routes). You don't have to worry about any additional code to manage sessions and token (for API).

Note

The Access Token is now validated with the AWS Cognito certificate. If the certificate is incorrect or expired, it will throw am exception.

The trait takes in some additional parameters, refer below the function signature of the trait. Note that the function takes the object of **Illuminate\\Support\\Collection** instead of **Illuminate\\Http\\Request**. This will allow you to use this function in any tier of the code.

Also, the 'guard' name reference is passed, so that you can reuse the function for multiple guard drivers in your project. The function has the capability to handle the Session and Token Guards with multiple drivers and providers as defined in /config/auth.php

```
    namespace Ellaisys\Cognito\Auth;

    protected function attemptLogin (
        Collection $request, string $guard='web',
        string $paramUsername='email', string $paramPassword='password',
        bool $isJsonResponse=false
    ) {
        ...
        ...

        ...
    }
```

In case you want to use this trait for Web login, you can write the code as shown below in the AuthController.php

```
    namespace App\Http\Controllers;

    ...

    use Ellaisys\Cognito\AwsCognitoClaim;
    use Ellaisys\Cognito\Auth\AuthenticatesUsers as CognitoAuthenticatesUsers;

    class AuthController extends Controller
    {
        use CognitoAuthenticatesUsers;

        /**
         * Authenticate User
         *
         * @throws \HttpException
         *
         * @return mixed
         */
        public function login(\Illuminate\Http\Request $request)
        {
            ...

            //Convert request to collection
            $collection = collect($request->all());

            //Authenticate with Cognito Package Trait (with 'web' as the auth guard)
            if ($response = $this->attemptLogin($collection, 'web')) {
                if ($response===true) {
                    return redirect(route('home'))->with('success', true);
                } elseif ($response===false) {
                    // If the login attempt was unsuccessful you may increment the number of attempts
                    // to login and redirect the user back to the login form. Of course, when this
                    // user surpasses their maximum number of attempts they will get locked out.
                    //
                    //$this->incrementLoginAttempts($request);
                    //
                    //$this->sendFailedLoginResponse($collection, null);
                } else {
                    return $response;
                } //End if
            } //End if

        } //Function ends

        ...
    } //Class ends
```

In case you want to use this trait for API based login, you can write the code as shown below in the AuthApiController.php

```
    namespace App\Api\Controller;

    ...

    use Ellaisys\Cognito\AwsCognitoClaim;
    use Ellaisys\Cognito\Auth\AuthenticatesUsers as CognitoAuthenticatesUsers;

    class AuthApiController extends Controller
    {
        use CognitoAuthenticatesUsers;

        /**
         * Authenticate User
         *
         * @throws \HttpException
         *
         * @return mixed
         */
        public function login(\Illuminate\Http\Request $request)
        {
            ...

            //Convert request to collection
            $collection = collect($request->all());

            //Authenticate with Cognito Package Trait (with 'api' as the auth guard)
            if ($claim = $this->attemptLogin($collection, 'api', 'username', 'password', true)) {
                if ($claim instanceof AwsCognitoClaim) {
                    return $claim->getData();
                } else {
                    return response()->json(['status' => 'error', 'message' => $claim], 400);
                } //End if
            } //End if

        } //Function ends

        ...
    } //Class ends
```

Signout (Remove Access Token)
-----------------------------

[](#signout-remove-access-token)

The logout methods are now part of the guard implementations, the logout method removes the access-tokens from AWS and also removes from Application Storage managed by this library. Just calling the auth guard logout method will be sufficient. You can implement it into the routes or controller based on your development preference.

The logout method now takes an **optional** boolean parameter (true) to revoke RefreshToken. The default value is (false) and that will persist the Refresh Token with AWS Cognito.

```
   ...

   Auth::guard('api')->logout();

   ...

   Auth::guard('api')->logout(true); //Revoke the Refresh Token.
```

Refresh Token
-------------

[](#refresh-token)

You can use this trait for API to generate new token

```
    namespace App\Api\Controller;

    ...

    use Ellaisys\Cognito\AwsCognitoClaim;
    use Ellaisys\Cognito\Auth\RefreshToken;

    class AuthApiController extends Controller
    {
        use RefreshToken;

        /**
         * Generate a new token using refresh token.
         *
         * @throws \HttpException
         *
         * @return mixed
         */
        public function refreshToken(\Illuminate\Http\Request $request)
        {
            ...

            $validator = $request->validate([
                'email' => 'required|email',
                'refresh_token' => 'required'
            ]);

            try {
                return $this->refresh($request, 'email', 'refresh_token');
            } catch (Exception $e) {
                return $e;
            }

        } //Function ends

        ...
    } //Class ends
```

Delete User
-----------

[](#delete-user)

If you want to give your users the ability to delete themselves from your app you can use our deleteUser function from the CognitoClient.

To delete the user you should call deleteUser and pass the email of the user as a parameter to it. After the user has been deleted in your cognito pool, delete your user from your database too.

```
        $cognitoClient->deleteUser($user->email);
        $user->delete();
```

We have implemented a new config option `delete_user`, which you can access through `AWS_COGNITO_DELETE_USER` env var. If you set this config to true, the user is deleted in the Cognito pool. If it is set to false, it will stay registered. Per default this option is set to false. If you want this behaviour you should set USE\_SSO to true to let the user restore themselves after a successful login.

To access our CognitoClient you can simply pass it as a parameter to your Controller Action where you want to perform the deletion.

```
    public function deleteUser(Request $request, AwsCognitoClient $client)
```

Laravel will take care of the dependency injection by itself.

```
    IMPORTANT: You want to secure this action by maybe security questions, a second delete password or by confirming
    the email address.

```

Storing Web Sessions or API Tokens in DynamoDB (Useful for multiserver/container implementation)
------------------------------------------------------------------------------------------------

[](#storing-web-sessions-or-api-tokens-in-dynamodb-useful-for-multiservercontainer-implementation)

If you have a deployment architecture, that involves multiple servers and you want to maintain the web sessions or API tokens across the servers, you can use the AWS DynamoDB. The library is capable of handling the DynamoDB with ease. All that you need to do is create the table in AWS DynamoDB and change a few configurations.

### Creating a new table in AWS DynamoDB

[](#creating-a-new-table-in-aws-dynamodb)

1. Go to the AWS Console and create a new table.
2. Enter the unique table name as per your preferences.
3. The primary key (or partition key) should be **key** of type **string**
4. Use default settings and click the **Create** button

### Update the .env file for Dynamo DB configurations

[](#update-the-env-file-for-dynamo-db-configurations)

Add/Edit the following fields to your `.env` file and set the values according to your AWS settings:

```
    # Cache Configuration
    CACHE_DRIVER="dynamodb"
    DYNAMODB_CACHE_TABLE="table-name-of-your-choice" //This should match the table name provided above

    # Session Configuration
    SESSION_DRIVER="dynamodb"
    SESSION_LIFETIME=120
    SESSION_DOMAIN="set-your-domain-name" //The domain name can be as per your preference
    SESSION_SECURE_COOKIE=true

    # DynamoDB Configuration
    DYNAMODB_ENDPOINT="https://dynamodb.us-west-2.amazonaws.com" // You can change the endpoint based of different regions
```

Refer the [AWS DynamoDB Documentation](https://docs.aws.amazon.com/general/latest/gr/ddb.html) and refer the endpoints provided in **Service endpoints** section.

Update the DynamoDB table for the TTL columns as **expires\_at**

Automatic User Password update for API usage (for New Cognito Users)
--------------------------------------------------------------------

[](#automatic-user-password-update-for-api-usage-for-new-cognito-users)

In case of the new cognito users, the AWS SDK will send a session key and the user is expected to change the password, in a forced mode. Make sure you force the users to change the password for the first login by new cognito user.

However, if you have an API based implementation, and want to automatically authenticate the user without forcing the password change, you may do that with below setting fields to your `.env` file

```
    AWS_COGNITO_FORCE_PASSWORD_CHANGE_API=false     //Make true for forcing password change
    AWS_COGNITO_FORCE_PASSWORD_AUTO_UPDATE_API=true //Make false for stopping auto password change
```

Support for App Client without Secret enabled
---------------------------------------------

[](#support-for-app-client-without-secret-enabled)

The library now supports where the AWS configuration of App Client with the Client Secret set to disabled. Use the below configuration into the environment file to enable/disable this. The default is marked as enable (i.e. we expect the App Client Secret to be enabled in AWS Cognito configuration)

```
   AWS_COGNITO_CLIENT_SECRET_ALLOW=false
```

Password Validation based of Cognito Configuration
--------------------------------------------------

[](#password-validation-based-of-cognito-configuration)

This library fetches the password policy from the cognito pool configurations. The laravel request validations are done based on the regular expression that is created based on this policy. This validations are performed during the Sign Up (Registation), Sign In (Login), Reset and Change password based flows. The validation messages for the password are also dynamic in nature and change based on the configurations.

Important

In case of special characters, we are supporting all except the pipe character **|** for now. We are working on making sure that pipe character is handled soon.

Mapping Cognito User using Subject UUID
---------------------------------------

[](#mapping-cognito-user-using-subject-uuid)

The library maps the Cognito user subject UUID with the local repository. Everytime a new user is created in cognito, the sub UUID is mapped with the local user table with an user specified column name.

The column name in the local database is identified as `sub`. This can be changed and managed with the config parameter `user_subject_uuid`. The default value of the config is set to `sub`.

However, to customize the column name in the local DB user table, you may do that with below setting fields to your `.env` file

```
    AWS_COGNITO_USER_SUBJECT_UUID="sub"

```

Important

In v2.0.5, we have released a trait to be included into your User Model. This includes ManagesSubject, ManagesRegistration and ManagesPasskey traits. Sample code of user model is shared. In case you have already implemented the sub column in your user table, you can use the below code snippet to include the trait into your User model.

```
    ...
    use Ellaisys\Cognito\Concerns\CognitoAuthenticatable;
    ...

    class User extends Authenticatable
    {
        ...
        use CognitoAuthenticatable;

        /**
         * The attributes that are mass assignable.
         *
         * @var array
         */
        protected $fillable = [
            'name',
            'email',
            'password',
            'sub'
        ];

        ...
        ...
    }
```

Changelog
---------

[](#changelog)

Please see [CHANGELOG](CHANGELOG.md) for more information on what has changed recently.

Security
--------

[](#security)

If you discover any security related issues, please email  and also add it to the issue tracker.

Roadmap
-------

[](#roadmap)

How to contribute
-----------------

[](#how-to-contribute)

- Star this project on GitHub.
- Report bugs or suggest features by creating new issues or adding comments to issues
- Submit pull requests
- Spread the word by blogging about SimplCommerce or sharing it on social networks
- Donate to us

Credits &amp; Contributors
--------------------------

[](#credits--contributors)

This project exists thanks to all the people who contribute.

- [EllaiSys Team](https://github.com/ellaisys)
- [GitHub Contributors](https://github.com/ellaisys/aws-cognito/graphs/contributors)

Click on these badges to see how you might be able to help:

[![GitHub repo Issues](https://camo.githubusercontent.com/506b6ea16771b5d40119966bd1df4e07b304f053ddc8020869ae8cd45f0f3953/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d726564266c6162656c3d497373756573)](https://github.com/ellaisys/aws-cognito/issues) [![GitHub repo Good Issues for newbies](https://camo.githubusercontent.com/bd6da50c630c350d7c57f5cacf1076411947392ad3eb0cdbdff96412f63aa340/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732f656c6c61697379732f6177732d636f676e69746f2f676f6f64253230666972737425323069737375653f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d677265656e266c6162656c3d476f6f642532304669727374253230697373756573)](https://github.com/ellaisys/aws-cognito/issues?q=is%3Aopen+is%3Aissue+label%3A%22good+first+issue%22) [![GitHub Help Wanted issues](https://camo.githubusercontent.com/b1ba91ed4072028a14992e579683ed45e3bf20e5d381f29be1b5e17a611a3ed4/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732f656c6c61697379732f6177732d636f676e69746f2f68656c7025323077616e7465643f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d623534356431266c6162656c3d25323248656c7025323057616e746564253232253230697373756573)](https://github.com/ellaisys/aws-cognito/issues?q=is%3Aopen+is%3Aissue+label%3A%22help+wanted%22)
[![GitHub repo PRs](https://camo.githubusercontent.com/40dc182fe295e585f192597fc7e9f295d89b8c5eb7f7249e81859052853d2daa/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732d70722f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d6f72616e6765266c6162656c3d505273)](https://github.com/ellaisys/aws-cognito/pulls) [![GitHub repo Merged PRs](https://camo.githubusercontent.com/c3b71346a151032f7a33ae79ae88ddb600adc48c0d3e5906306d2f24c8560c05/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732d7365617263682f656c6c61697379732f6177732d636f676e69746f3f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d677265656e266c6162656c3d4d65726765642532305052732671756572793d69732533416d6572676564)](https://github.com/ellaisys/aws-cognito/pulls?q=is%3Apr+is%3Amerged) [![GitHub Help Wanted PRs](https://camo.githubusercontent.com/b12874750d76938443b1e7d5e40c43ef4347bf16f821e10da5ba94466c2bf05e/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f6973737565732d70722f656c6c61697379732f6177732d636f676e69746f2f68656c7025323077616e7465643f7374796c653d666c6174266c6f676f3d676974687562266c6f676f436f6c6f723d623534356431266c6162656c3d25323248656c7025323057616e746564253232253230505273)](https://github.com/ellaisys/aws-cognito/pulls?q=is%3Aopen+is%3Aissue+label%3A%22help+wanted%22)

Support us
----------

[](#support-us)

EllaiSys was a web and consulting agency specialized in Cloud Computing (AWS and Azure), DevOps, and Product Engneering. We closed our professional services offerings from Oct 2021, however the team continues to support the open source projects as our commitment towards the community. Anyone interested to support the development is welcome.

License
-------

[](#license)

The MIT License (MIT). Please see [License File](LICENSE.md) for more information.

Disclaimer
----------

[](#disclaimer)

*This package is currently in production ready mode with already a few implementations done. We would be happy to hear from you, about the defects or new feature enhancements. However, this being a free support, we would not be able to commit to support SLAs or timelines.*

###  Health Score

66

—

FairBetter than 99% of packages

Maintenance96

Actively maintained with recent releases

Popularity53

Moderate usage in the ecosystem

Community28

Small or concentrated contributor base

Maturity74

Established project with proven stability

 Bus Factor1

Top contributor holds 69.2% of commits — single point of failure

How is this calculated?**Maintenance (25%)** — Last commit recency, latest release date, and issue-to-star ratio. Uses a 2-year decay window.

**Popularity (30%)** — Total and monthly downloads, GitHub stars, and forks. Logarithmic scaling prevents top-heavy scores.

**Community (15%)** — Contributors, dependents, forks, watchers, and maintainers. Measures real ecosystem engagement.

**Maturity (30%)** — Project age, version count, PHP version support, and release stability.

###  Release Activity

Cadence

Every ~42 days

Recently: every ~16 days

Total

50

Last Release

5d ago

Major Versions

v0.1.13 → v1.0.02021-07-14

v1.4.1 → v2.0.02026-03-13

PHP version history (5 changes)v0.1.0PHP ^7.2.5

v0.1.3PHP ^7.0

v1.0.0PHP &gt;=7.0

v1.0.1PHP ^7.0|^8.0

v2.0.5PHP ^7.4|^8.0

### Community

Maintainers

![](https://avatars.githubusercontent.com/u/20050863?v=4)[EllaiSys](/maintainers/ellaisys)[@ellaisys](https://github.com/ellaisys)

![](https://www.gravatar.com/avatar/8a16481c18ce9a217dc2ae1325163087756f4f15ea76133cd28e91ebc59a667a?d=identicon)[amitdhongde](/maintainers/amitdhongde)

---

Top Contributors

[![amitdhongde](https://avatars.githubusercontent.com/u/24870900?v=4)](https://github.com/amitdhongde "amitdhongde (54 commits)")[![fpena](https://avatars.githubusercontent.com/u/440097?v=4)](https://github.com/fpena "fpena (8 commits)")[![farnsworthMars](https://avatars.githubusercontent.com/u/1650516?v=4)](https://github.com/farnsworthMars "farnsworthMars (5 commits)")[![Aniruddh-J](https://avatars.githubusercontent.com/u/1218651?v=4)](https://github.com/Aniruddh-J "Aniruddh-J (2 commits)")[![jefersondornellescomerc](https://avatars.githubusercontent.com/u/244704974?v=4)](https://github.com/jefersondornellescomerc "jefersondornellescomerc (1 commits)")[![joshkautz](https://avatars.githubusercontent.com/u/17554471?v=4)](https://github.com/joshkautz "joshkautz (1 commits)")[![minhchu](https://avatars.githubusercontent.com/u/14136809?v=4)](https://github.com/minhchu "minhchu (1 commits)")[![sunnydesign](https://avatars.githubusercontent.com/u/36501326?v=4)](https://github.com/sunnydesign "sunnydesign (1 commits)")[![aaronhuisinga](https://avatars.githubusercontent.com/u/2423844?v=4)](https://github.com/aaronhuisinga "aaronhuisinga (1 commits)")[![ZhariffAdam](https://avatars.githubusercontent.com/u/10986512?v=4)](https://github.com/ZhariffAdam "ZhariffAdam (1 commits)")[![amarnik](https://avatars.githubusercontent.com/u/1010830?v=4)](https://github.com/amarnik "amarnik (1 commits)")[![danilopinotti](https://avatars.githubusercontent.com/u/11338999?v=4)](https://github.com/danilopinotti "danilopinotti (1 commits)")[![gjnvro](https://avatars.githubusercontent.com/u/79240437?v=4)](https://github.com/gjnvro "gjnvro (1 commits)")

---

Tags

api-authenticationauthenticationauthentication-middlewareaws-cognitoaws-sdkcognitocognito-poolfido2google-authenticatorjwtlaravellaravel-cognitolaravel-packagemfapasskeyspasswordlessphpuser-poolphpjwtlaravelawsauthAuthenticationemailpasswordJSON Web Token2faTwo Factor AuthenticationphonesmsoauthfidoFIDO2webauthnCognitoupdateMFAPasswordlesspasskeyMulti Factor Authenticationemail-verificationemail confirmationforgotresetchangesms verificationEmail confirmphone verificationemail tokenuser poolellaisyssms codePhone codephone confirmationsms confirmationemail codephone tokensms tokenemail recoveryphone recoverysms recoveryemail resetphone resetsms resetemail forgotphone forgotsms forgotsms updatephone confirmsms confirmforgot passwordaws-sdkjwt-tokenchange passwordaws-sdk-phpAWS Cognitoupdate passwordverify-codesrp protocolsecure remote password protocolconfirm codetoken verifyidentity pooldevice authentication

###  Code Quality

TestsPHPUnit

### Embed Badge

![Health badge](/badges/ellaisys-aws-cognito/health.svg)

```
[![Health](https://phpackages.com/badges/ellaisys-aws-cognito/health.svg)](https://phpackages.com/packages/ellaisys-aws-cognito)
```

###  Alternatives

[auth0/login

Auth0 Laravel SDK. Straight-forward and tested methods for implementing authentication, and accessing Auth0's Management API endpoints.

2795.3M3](/packages/auth0-login)[benbjurstrom/cognito-jwt-guard

A laravel auth guard for JSON Web Tokens issued by Amazon AWS Cognito

1113.1k](/packages/benbjurstrom-cognito-jwt-guard)

PHPackages © 2026

[Directory](/)[Categories](/categories)[Trending](/trending)[Changelog](/changelog)[Analyze](/analyze)
